Germany
Japan
United Kingdom
China
NEUROD1 (Myc-DDK-tagged)-Human neurogenic differentiation 1 (NEUROD1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
NEUROD1 (untagged)-Human neurogenic differentiation 1 (NEUROD1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human neurogenic differentiation 1 (NEUROD1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
NEUROD1 (GFP-tagged) - Human neurogenic differentiation 1 (NEUROD1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, NEUROD1 (Myc-DDK tagged) - Human neurogenic differentiation 1 (NEUROD1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NEUROD1 (mGFP-tagged) - Human neurogenic differentiation 1 (NEUROD1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, NEUROD1 (Myc-DDK tagged) - Human neurogenic differentiation 1 (NEUROD1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human neurogenic differentiation 1 (NEUROD1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NEUROD1 (mGFP-tagged) - Human neurogenic differentiation 1 (NEUROD1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human neurogenic differentiation 1 (NEUROD1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Lenti ORF clone of Human neurogenic differentiation 1 (NEUROD1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human neurogenic differentiation 1 (NEUROD1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit polyclonal NeuroD1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1. |
Transient overexpression lysate of neurogenic differentiation 1 (NEUROD1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NEUROD1 (untagged)-Human neurogenic differentiation 1 (NEUROD1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-Neuro D Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Neuro D Antibody: A synthesized peptide derived from human Neuro D |
NEUROD1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal Neuro D (Ab-274) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Neuro D around the phosphorylation site of serine 272 (P-L-SP-P-P-). |
Rabbit polyclonal NeuroD1 Antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-348 amino acids from the C-terminal region of human NeuroD1. |
Rabbit Polyclonal Anti-NEUROD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEUROD1 antibody: synthetic peptide directed towards the N terminal of human NEUROD1. Synthetic peptide located within the following region: MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEE |
Rabbit Polyclonal Anti-NEUROD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NEUROD1 Antibody: synthetic peptide directed towards the middle region of human NEUROD1. Synthetic peptide located within the following region: ATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFH |
NEUROD1 MS Standard C13 and N15-labeled recombinant protein (NP_002491)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of NEUROD1 (NM_002500) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NEUROD1 (NM_002500) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NEUROD1 (NM_002500) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- NEUROD1
Families
- Embryonic stem cells