Products

cDNA Clones (29)
Antibodies (18)
Proteins (18)
Jump to Filters
View as table Download
PAX7 (NM_002584) Human Tagged ORF Clone
RC213482

USD 420.00

In Stock

PAX7 (Myc-DDK-tagged)-Human paired box 7 (PAX7), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX7 (NM_013945) Human Tagged ORF Clone
RC216836

USD 420.00

In Stock

PAX7 (Myc-DDK-tagged)-Human paired box 7 (PAX7), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX7 (NM_001135254) Human Tagged ORF Clone
RC225868

USD 470.00

In Stock

PAX7 (Myc-DDK-tagged)-Human paired box 7 (PAX7), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX7 (NM_013945) Human Tagged ORF Clone
RG216836

USD 460.00

In Stock

PAX7 (GFP-tagged) - Human paired box 7 (PAX7), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX7 (NM_002584) Human Tagged ORF Clone Lentiviral Particle
RC213482L1V

USD 820.00

3 Weeks

Lenti ORF particles, PAX7 (Myc-DDK tagged) - Human paired box 7 (PAX7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PAX7 (NM_002584) Human Tagged ORF Clone Lentiviral Particle
RC213482L2V

USD 820.00

6 Weeks

Lenti ORF particles, PAX7 (mGFP-tagged) - Human paired box 7 (PAX7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PAX7 (NM_013945) Human Tagged ORF Clone Lentiviral Particle
RC216836L1V

USD 820.00

3 Weeks

Lenti ORF particles, PAX7 (Myc-DDK tagged) - Human paired box 7 (PAX7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PAX7 (NM_013945) Human Tagged ORF Clone Lentiviral Particle
RC216836L2V

USD 820.00

6 Weeks

Lenti ORF particles, PAX7 (mGFP-tagged) - Human paired box 7 (PAX7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PAX7 (NM_002584) Human Tagged ORF Clone
RG213482

USD 460.00

In Stock

PAX7 (GFP-tagged) - Human paired box 7 (PAX7), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX7 (NM_002584) Human Tagged ORF Clone
RC213482L3

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 7 (PAX7), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX7 (NM_002584) Human Tagged ORF Clone Lentiviral Particle
RC213482L3V

USD 820.00

5 Weeks

Lenti ORF particles, PAX7 (Myc-DDK tagged) - Human paired box 7 (PAX7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX7 (NM_002584) Human Tagged ORF Clone
RC213482L4

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 7 (PAX7), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX7 (NM_002584) Human Tagged ORF Clone Lentiviral Particle
RC213482L4V

USD 820.00

7 Weeks

Lenti ORF particles, PAX7 (mGFP-tagged) - Human paired box 7 (PAX7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX7 (NM_013945) Human Tagged ORF Clone
RC216836L3

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 7 (PAX7), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX7 (NM_013945) Human Tagged ORF Clone Lentiviral Particle
RC216836L3V

USD 820.00

5 Weeks

Lenti ORF particles, PAX7 (Myc-DDK tagged) - Human paired box 7 (PAX7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX7 (NM_013945) Human Tagged ORF Clone
RC216836L4

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 7 (PAX7), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX7 (NM_013945) Human Tagged ORF Clone Lentiviral Particle
RC216836L4V

USD 820.00

7 Weeks

Lenti ORF particles, PAX7 (mGFP-tagged) - Human paired box 7 (PAX7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX7 (NM_001135254) Human Tagged ORF Clone
RC225868L3

USD 670.00

3 Weeks

Lenti-ORF clone of PAX7 (Myc-DDK-tagged)-Human paired box 7 (PAX7), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX7 (NM_001135254) Human Tagged ORF Clone
RC225868L4

USD 670.00

3 Weeks

Lenti-ORF clone of PAX7 (mGFP-tagged)-Human paired box 7 (PAX7), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX7 (NM_001135254) Human Tagged ORF Clone
RG225868

USD 520.00

3 Weeks

PAX7 (GFP-tagged) - Human paired box 7 (PAX7), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX7 (NM_002584) Human Tagged ORF Clone
RC213482L1

USD 768.00

In Stock

Lenti ORF clone of Human paired box 7 (PAX7), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PAX7 (NM_013945) Human Tagged ORF Clone
RC216836L1

USD 768.00

In Stock

Lenti ORF clone of Human paired box 7 (PAX7), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PAX7 (NM_002584) Human Over-expression Lysate
LY429110

USD 396.00

In Stock

Transient overexpression lysate of paired box 7 (PAX7), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX7 (NM_002584) Human Untagged Clone
SC303223

USD 760.00

In Stock

PAX7 (untagged)-Human paired box 7 (PAX7), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PAX7 (411-521) Mouse Monoclonal Antibody [Clone ID: 1E12]
AM20925PU-N

USD 480.00

2 Weeks

PAX7 (411-521) mouse monoclonal antibody, clone 1E12, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
PAX7 (C-term) Rabbit Polyclonal Antibody
AP53182PU-N

USD 450.00

2 Weeks

PAX7 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 417-445 amino acids from the C-terminal region of human PAX7
PAX7 (NM_002584) Human Tagged ORF Clone
RC213482L2

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 7 (PAX7), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PAX7 (NM_013945) Human Tagged ORF Clone
RC216836L2

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 7 (PAX7), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PAX7 (NM_013945) Human Over-expression Lysate
LC415548

USD 187.00

In Stock

PAX7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX7 (NM_001135254) Human Over-expression Lysate
LY427610

USD 396.00

In Stock

Transient overexpression lysate of paired box 7 (PAX7), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX7 Rabbit Polyclonal Antibody
TA330281

USD 375.00

5 Days

Rabbit Polyclonal Anti-PAX7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK
PAX7 (NM_002584) Human Recombinant Protein
TP761950

USD 215.00

In Stock

Purified recombinant protein of Human paired box 7 (PAX7), transcript variant 1,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
PAX7 (Center) Rabbit Polyclonal Antibody
AP53181PU-N

USD 450.00

2 Weeks

PAX7 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 180-210 amino acids from the Central region of human PAX
PAX7 Rabbit Polyclonal Antibody
TA329891

USD 375.00

5 Days

Rabbit Polyclonal Anti-PAX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the middle region of human PAX7. Synthetic peptide located within the following region: KPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPI
PAX7 Rabbit Polyclonal Antibody
TA330280

USD 375.00

5 Days

Rabbit Polyclonal Anti-PAX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: CDRSTVPSGLVSSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGIL
PAX7 Rabbit Polyclonal Antibody
TA331136

USD 375.00

5 Days

Rabbit Polyclonal Anti-PAX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PAX7 antibody is: synthetic peptide directed towards the C-terminal region of PAX7. Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT
PAX7 Mouse Monoclonal Antibody [Clone ID: OTI4A7]
CF811661

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAX7 mouse monoclonal antibody,clone OTI4A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PAX7 Mouse Monoclonal Antibody [Clone ID: OTI4G5]
CF811671

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAX7 mouse monoclonal antibody,clone OTI4G5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PAX7 (NM_002584) Human Over-expression Lysate
LC419235

USD 187.00

2 Weeks

PAX7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX7 (NM_001135254) Human Over-expression Lysate
LC427610

USD 121.00

2 Weeks

PAX7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX7 (NM_002584) Human Over-expression Lysate
LC429110

USD 121.00

2 Weeks

PAX7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX7 (NM_013945) Human Over-expression Lysate
LY415548

USD 605.00

5 Days

Transient overexpression lysate of paired box 7 (PAX7), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX7 (NM_002584) Human Over-expression Lysate
LY419235

USD 605.00

5 Days

Transient overexpression lysate of paired box 7 (PAX7), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY419235 is the same product as LY429110.
PAX7 (NM_013945) Human Untagged Clone
SC304018

USD 760.00

4 Weeks

PAX7 (untagged)-Human paired box 7 (PAX7), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PAX7 (NM_001135254) Human Untagged Clone
SC326000

USD 850.00

3 Weeks

PAX7 (untagged)-Human paired box 7 (PAX7), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PAX7 Rabbit Polyclonal Antibody
TA323861

USD 345.00

4 Weeks

Anti-PAX7 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 245 amino acids of human paired box 7
PAX7 Mouse Monoclonal Antibody [Clone ID: OTI4A7]
TA811661

USD 379.00

In Stock

PAX7 mouse monoclonal antibody,clone OTI4A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PAX7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A7]
TA811661AM

USD 420.00

4 Weeks

PAX7 mouse monoclonal antibody,clone OTI4A7, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin