Products

cDNA Clones (27)
Antibodies (26)
Proteins (22)
Jump to Filters
View as table Download
OTX2 (NM_021728) Human Tagged ORF Clone
RC207479

USD 420.00

In Stock

OTX2 (Myc-DDK-tagged)-Human orthodenticle homeobox 2 (OTX2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
OTX2 (NM_021728) Human Tagged ORF Clone Lentiviral Particle
RC207479L2V

USD 1,020.00

3 Weeks

Lenti ORF particles, OTX2 (mGFP-tagged) - Human orthodenticle homeobox 2 (OTX2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
OTX2 (NM_172337) Human Tagged ORF Clone
RC219004

USD 420.00

In Stock

OTX2 (Myc-DDK-tagged)-Human orthodenticle homeobox 2 (OTX2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
OTX2 (NM_021728) Human Untagged Clone
SC111661

USD 310.00

In Stock

OTX2 (untagged)-Human orthodenticle homeobox 2 (OTX2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
OTX2 (NM_021728) Human Tagged ORF Clone Lentiviral Particle
RC207479L1V

USD 820.00

3 Weeks

Lenti ORF particles, OTX2 (Myc-DDK tagged) - Human orthodenticle homeobox 2 (OTX2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
OTX2 (NM_021728) Human Tagged ORF Clone
RG207479

USD 460.00

In Stock

OTX2 (GFP-tagged) - Human orthodenticle homeobox 2 (OTX2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OTX2 (NM_001270523) Human Tagged ORF Clone
RC233665

USD 420.00

In Stock

OTX2 (Myc-DDK tagged) - Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
OTX2 (NM_001270524) Human Tagged ORF Clone
RC233666

USD 420.00

In Stock

OTX2 (Myc-DDK tagged) - Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
OTX2 (NM_001270525) Human Tagged ORF Clone
RC233688

USD 420.00

In Stock

OTX2 (Myc-DDK tagged) - Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
OTX2 (NM_021728) Human Tagged ORF Clone
RC207479L3

USD 620.00

3 Weeks

Lenti ORF clone of Human orthodenticle homeobox 2 (OTX2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OTX2 (NM_021728) Human Tagged ORF Clone Lentiviral Particle
RC207479L3V

USD 820.00

5 Weeks

Lenti ORF particles, OTX2 (Myc-DDK tagged) - Human orthodenticle homeobox 2 (OTX2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OTX2 (NM_021728) Human Tagged ORF Clone
RC207479L4

USD 620.00

In Stock

Lenti ORF clone of Human orthodenticle homeobox 2 (OTX2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OTX2 (NM_172337) Human Tagged ORF Clone
RC219004L3

USD 620.00

3 Weeks

Lenti ORF clone of Human orthodenticle homeobox 2 (OTX2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OTX2 (NM_172337) Human Tagged ORF Clone Lentiviral Particle
RC219004L3V

USD 820.00

6 Weeks

Lenti ORF particles, OTX2 (Myc-DDK tagged) - Human orthodenticle homeobox 2 (OTX2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OTX2 (NM_172337) Human Tagged ORF Clone Lentiviral Particle
RC219004L4V

USD 820.00

6 Weeks

Lenti ORF particles, OTX2 (mGFP-tagged) - Human orthodenticle homeobox 2 (OTX2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OTX2 (NM_172337) Human Tagged ORF Clone
RG219004

USD 460.00

3 Weeks

OTX2 (GFP-tagged) - Human orthodenticle homeobox 2 (OTX2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OTX2 (NM_001270523) Human Tagged ORF Clone
RG233665

USD 460.00

3 Weeks

OTX2 (GFP-tagged) - Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OTX2 (NM_001270524) Human Tagged ORF Clone
RG233666

USD 460.00

3 Weeks

OTX2 (GFP-tagged) - Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OTX2 (NM_001270525) Human Tagged ORF Clone
RG233688

USD 460.00

3 Weeks

OTX2 (GFP-tagged) - Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OTX2 (NM_021728) Human Recombinant Protein
TP760159

USD 215.00

In Stock

Recombinant protein of human orthodenticle homeobox 2 (OTX2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
OTX2 (NM_021728) Human Tagged Lenti ORF Clone
RC207479L1

USD 768.00

In Stock

Lenti ORF clone of Human orthodenticle homeobox 2 (OTX2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
OTX2 (NM_172337) Human Tagged ORF Clone
RC219004L4

USD 768.00

In Stock

Lenti ORF clone of Human orthodenticle homeobox 2 (OTX2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OTX2 Rabbit Polyclonal Antibody
TA330538

USD 375.00

5 Days

Rabbit Polyclonal Anti-OTX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT
OTX2 (NM_021728) Human Tagged ORF Clone
RC207479L2

USD 620.00

In Stock

Lenti ORF clone of Human orthodenticle homeobox 2 (OTX2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
OTX2 (NM_021728) Human Over-expression Lysate
LY411946

USD 396.00

In Stock

Transient overexpression lysate of orthodenticle homeobox 2 (OTX2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OTX2 Rabbit Polyclonal Antibody
TA332711

USD 275.00

3 Weeks

Rabbit anti-OTX2 Polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human OTX2
OTX2 (NM_021728) Human Over-expression Lysate
LC411946

USD 121.00

In Stock

OTX2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OTX2 (NM_172337) Human Over-expression Lysate
LY406713

USD 396.00

In Stock

Transient overexpression lysate of orthodenticle homeobox 2 (OTX2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY406713 is the same product as LY430370.
OTX2 Rabbit Monoclonal Antibody [Clone ID: EPR3348]
TA307061

USD 508.00

In Stock

Rabbit monoclonal antibody against OTX2(clone EPR3348)

Applications WB
Reactivities Human
Conjugation Unconjugated
OTX2 Rabbit Polyclonal Antibody
TA590374

USD 409.00

In Stock

Rabbit Polyclonal Otx2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
OTX2 (NM_172337) Human Over-expression Lysate
LC406713

USD 121.00

In Stock

OTX2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OTX2 (NM_172337) Human Over-expression Lysate
LC430370

USD 121.00

2 Weeks

OTX2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OTX2 Rabbit Polyclonal Antibody
TA329270

USD 375.00

5 Days

Rabbit Polyclonal anti-OTX2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the middle region of human OTX2. Synthetic peptide located within the following region: NGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSI
OTX2 Rabbit Polyclonal Antibody
TA330539

USD 375.00

5 Days

Rabbit Polyclonal Anti-OTX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the middle region of human OTX2. Synthetic peptide located within the following region: QQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPV
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF809509

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) OTX2 mouse monoclonal antibody,clone OTI1B2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI2B3]
CF809510

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) OTX2 mouse monoclonal antibody,clone OTI2B3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI1A1]
CF809511

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) OTX2 mouse monoclonal antibody,clone OTI1A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI3G9]
CF809627

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) OTX2 mouse monoclonal antibody, clone OTI3G9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
OTX2 (NM_172337) Human Over-expression Lysate
LY430370

USD 396.00

5 Days

Transient overexpression lysate of orthodenticle homeobox 2 (OTX2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OTX2 (NM_021728) Human Tagged ORF Clone Lentiviral Particle
RC207479L4V

USD 820.00

3 Weeks

Lenti ORF particles, OTX2 (mGFP-tagged) - Human orthodenticle homeobox 2 (OTX2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OTX2 (NM_172337) Human Untagged Clone
SC306753

USD 660.00

3 Weeks

OTX2 (untagged)-Human orthodenticle homeobox 2 (OTX2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
OTX2 (NM_001270523) Human Untagged Clone
SC332966

USD 310.00

3 Weeks

OTX2 (untagged) - Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 3

Vector pCMV6 series
Tag Tag Free
OTX2 (NM_001270524) Human Untagged Clone
SC332967

USD 310.00

3 Weeks

OTX2 (untagged) - Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 4

Vector pCMV6 series
Tag Tag Free
OTX2 (NM_001270525) Human Untagged Clone
SC332968

USD 310.00

3 Weeks

OTX2 (untagged) - Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 5

Vector pCMV6 series
Tag Tag Free
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI1B2]
TA809509

USD 379.00

In Stock

OTX2 mouse monoclonal antibody,clone OTI1B2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
OTX2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B2]
TA809509AM

USD 420.00

4 Weeks

OTX2 mouse monoclonal antibody,clone OTI1B2, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
OTX2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B2]
TA809509BM

USD 420.00

4 Weeks

OTX2 mouse monoclonal antibody,clone OTI1B2, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI1B2]
TA809509S

USD 159.00

2 Days

OTX2 mouse monoclonal antibody,clone OTI1B2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI2B3]
TA809510

USD 379.00

In Stock

OTX2 mouse monoclonal antibody,clone OTI2B3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated