Products

cDNA Clones (25)
Proteins (13)
Antibodies (5)
Jump to Filters
View as table Download
KCNMB2 (NM_005832) Human Tagged ORF Clone
RC204688

USD 98.00

USD 390.00

In Stock

KCNMB2 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KCNMB2 (NM_181361) Human Tagged ORF Clone
RC222841

USD 420.00

In Stock

KCNMB2 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KCNMB2 (NM_181361) Human Tagged ORF Clone Lentiviral Particle
RC222841L1V

USD 820.00

3 Weeks

Lenti ORF particles, KCNMB2 (Myc-DDK tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
KCNMB2 (NM_005832) Human Tagged ORF Clone Lentiviral Particle
RC204688L1V

USD 820.00

3 Weeks

Lenti ORF particles, KCNMB2 (Myc-DDK tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
KCNMB2 (NM_005832) Human Tagged ORF Clone Lentiviral Particle
RC204688L2V

USD 820.00

6 Weeks

Lenti ORF particles, KCNMB2 (mGFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
KCNMB2 (NM_181361) Human Tagged ORF Clone Lentiviral Particle
RC222841L2V

USD 820.00

6 Weeks

Lenti ORF particles, KCNMB2 (mGFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
KCNMB2 (NM_001278911) Human Tagged ORF Clone
RC236786

USD 420.00

In Stock

KCNMB2 (myc-DDK-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMB2 (NM_005832) Human Tagged ORF Clone
RG204688

USD 460.00

In Stock

KCNMB2 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMB2 (NM_005832) Human Tagged ORF Clone
RC204688L3

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB2 (NM_005832) Human Tagged ORF Clone Lentiviral Particle
RC204688L3V

USD 820.00

5 Weeks

Lenti ORF particles, KCNMB2 (Myc-DDK tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB2 (NM_005832) Human Tagged ORF Clone
RC204688L4

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB2 (NM_005832) Human Tagged ORF Clone Lentiviral Particle
RC204688L4V

USD 820.00

7 Weeks

Lenti ORF particles, KCNMB2 (mGFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB2 (NM_181361) Human Tagged ORF Clone
RC222841L3

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB2 (NM_181361) Human Tagged ORF Clone Lentiviral Particle
RC222841L3V

USD 820.00

5 Weeks

Lenti ORF particles, KCNMB2 (Myc-DDK tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB2 (NM_181361) Human Tagged ORF Clone
RC222841L4

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB2 (NM_181361) Human Tagged ORF Clone Lentiviral Particle
RC222841L4V

USD 820.00

7 Weeks

Lenti ORF particles, KCNMB2 (mGFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMB2 (NM_181361) Human Tagged ORF Clone
RG222841

USD 460.00

3 Weeks

KCNMB2 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMB2 (NM_181361) Human Tagged ORF Clone
RC222841L1

USD 768.00

In Stock

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
KCNMB2 (NM_005832) Human Tagged ORF Clone
RC204688L1

USD 768.00

In Stock

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
KCNMB2 (NM_005832) Human Tagged ORF Clone
RC204688L2

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
KCNMB2 (NM_181361) Human Tagged ORF Clone
RC222841L2

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
KCNMB2 (NM_181361) Human Untagged Clone
SC309268

USD 420.00

In Stock

KCNMB2 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
KCNMB2 Rabbit Polyclonal Antibody
TA315036

USD 345.00

In Stock

Rabbit polyclonal anti-KCNMB2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KCNMB2.
KCNMB2 (NM_005832) Human Over-expression Lysate
LC401775

USD 121.00

In Stock

KCNMB2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
KCNMB2 (NM_005832) Human Over-expression Lysate
LY401775

USD 396.00

5 Days

Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB2 (NM_005832) Human Untagged Clone
SC319935

USD 310.00

In Stock

KCNMB2 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
KCNMB2 Rabbit Polyclonal Antibody
TA328638

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-slobeta2 (KCNMB2)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RHDEKRNIYQKIRDHDLLD, corresponding to amino acid residues 14-32 of human sloÃ?2.Intracellular, N-terminal part.
KCNMB2 Mouse Monoclonal Antibody [Clone ID: S53-32]
TA326488

USD 410.00

5 Days

Mouse Monoclonal Anti-BK Beta2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
KCNMB2 Rabbit Polyclonal Antibody
TA338783

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNMB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KCNMB2 antibody is: synthetic peptide directed towards the C-terminal region of Human KCNMB2. Synthetic peptide located within the following region: QKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTK
KCNMB2 (NM_181361) Human Over-expression Lysate
LC405752

USD 121.00

2 Weeks

KCNMB2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB2 (NM_181361) Human Over-expression Lysate
LY405752

USD 396.00

5 Days

Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMB2 (NM_001278911) Human Tagged ORF Clone
RG236786

USD 460.00

2 Weeks

KCNMB2 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMB2 (NM_001278911) Human Untagged Clone
SC334680

USD 341.00

2 Weeks

KCNMB2 (untagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
KCNMB2 Rabbit Polyclonal Antibody
TA351320

USD 345.00

In Stock

Rabbit Polyclonal Anti-KCNMB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNMB2
KCNMB2 (NM_005832) ICC Control Block
TB404688

USD 1,040.00

4 Weeks

Transient overexpression of KCNMB2 (NM_005832) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCNMB2 (NM_181361) ICC Control Block
TB422841

USD 1,070.00

4 Weeks

Transient overexpression of KCNMB2 (NM_181361) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCNMB2 (NM_001278911) ICC Control Block
TB436786

USD 1,070.00

4 Weeks

Transient overexpression of KCNMB2 (NM_001278911) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCNMB2 Cytosection
TS404688

USD 225.00

4 Weeks

Transient overexpression of KCNMB2 (NM_005832) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCNMB2 Cytosection
TS404688P5

USD 889.00

4 Weeks

Transient overexpression of KCNMB2 (NM_005832) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

KCNMB2 Cytosection
TS422841

USD 225.00

4 Weeks

Transient overexpression of KCNMB2 (NM_181361) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCNMB2 Cytosection
TS422841P5

USD 889.00

4 Weeks

Transient overexpression of KCNMB2 (NM_181361) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

KCNMB2 Cytosection
TS436786

USD 225.00

4 Weeks

Transient overexpression of KCNMB2 (NM_001278911) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCNMB2 Cytosection
TS436786P5

USD 889.00

4 Weeks

Transient overexpression of KCNMB2 (NM_001278911) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack