Products

cDNA Clones (25)
Proteins (12)
Antibodies (2)
Jump to Filters
View as table Download
CLCN6 (NM_021737) Human Tagged ORF Clone
RC217449

USD 420.00

In Stock

CLCN6 (Myc-DDK-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6d

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CLCN6 (NM_001286) Human Tagged ORF Clone
RG221294

USD 460.00

In Stock

CLCN6 (GFP-tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 (NM_021736) Human Tagged ORF Clone
RC221261

USD 420.00

In Stock

CLCN6 (Myc-DDK-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6c

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 (NM_021737) Human Tagged ORF Clone
RC217449L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chloride channel 6 (CLCN6), transcript variant ClC-6d, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021737) Human Tagged ORF Clone Lentiviral Particle
RC217449L3V

USD 820.00

6 Weeks

Lenti ORF particles, CLCN6 (Myc-DDK tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6d, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021737) Human Tagged ORF Clone
RC217449L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chloride channel 6 (CLCN6), transcript variant ClC-6d, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021737) Human Tagged ORF Clone Lentiviral Particle
RC217449L4V

USD 820.00

6 Weeks

Lenti ORF particles, CLCN6 (mGFP-tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6d, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021736) Human Tagged ORF Clone
RC221261L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chloride channel 6 (CLCN6), transcript variant ClC-6c, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021736) Human Tagged ORF Clone Lentiviral Particle
RC221261L3V

USD 820.00

6 Weeks

Lenti ORF particles, CLCN6 (Myc-DDK tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6c, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021736) Human Tagged ORF Clone
RC221261L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chloride channel 6 (CLCN6), transcript variant ClC-6c, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021736) Human Tagged ORF Clone Lentiviral Particle
RC221261L4V

USD 820.00

6 Weeks

Lenti ORF particles, CLCN6 (mGFP-tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6c, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_001286) Human Tagged ORF Clone
RC221294

USD 420.00

3 Weeks

CLCN6 (Myc-DDK-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 (NM_001286) Human Tagged ORF Clone
RC221294L3

USD 620.00

3 Weeks

Lenti-ORF clone of CLCN6 (Myc-DDK-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6a

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_001286) Human Tagged ORF Clone Lentiviral Particle
RC221294L3V

USD 820.00

6 Weeks

Lenti ORF particles, CLCN6 (Myc-DDK-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_001286) Human Tagged ORF Clone
RC221294L4

USD 620.00

3 Weeks

Lenti-ORF clone of CLCN6 (mGFP-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6a

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_001286) Human Tagged ORF Clone Lentiviral Particle
RC221294L4V

USD 820.00

6 Weeks

Lenti ORF particles, CLCN6 (mGFP-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_001256959) Human Tagged ORF Clone
RC234960

USD 750.00

5 Weeks

CLCN6 (Myc-DDK tagged) - Homo sapiens chloride channel, voltage-sensitive 6 (CLCN6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 (NM_021737) Human Tagged ORF Clone
RG217449

USD 460.00

3 Weeks

CLCN6 (GFP-tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6d

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 (NM_021736) Human Tagged ORF Clone
RG221261

USD 460.00

3 Weeks

CLCN6 (GFP-tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6c

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 (NM_001256959) Human Tagged ORF Clone
RG234960

USD 830.00

5 Weeks

CLCN6 (GFP-tagged) - Homo sapiens chloride channel, voltage-sensitive 6 (CLCN6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 (NM_021735) Human Untagged Clone
SC109072

USD 660.00

In Stock

CLCN6 (untagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6b

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CLCN6 Rabbit Polyclonal Antibody
AP01392PU-N

USD 370.00

2 Weeks

CLCN6 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
CLCN6 Rabbit Polyclonal Antibody
TA338699

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLCN6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLCN6 antibody: synthetic peptide directed towards the C terminal of human CLCN6. Synthetic peptide located within the following region: PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS
CLCN6 (NM_021737) Human Over-expression Lysate
LC411931

USD 121.00

2 Weeks

CLCN6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CLCN6 (NM_021736) Human Untagged Clone
SC308816

USD 600.00

3 Weeks

CLCN6 (untagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6c

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CLCN6 (NM_021737) Human Untagged Clone
SC309476

USD 660.00

3 Weeks

CLCN6 (untagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6d

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CLCN6 (NM_001286) Human Untagged Clone
SC314843

USD 760.00

5 Weeks

CLCN6 (untagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6a

Vector pCMV6 series
Tag Tag Free
CLCN6 (NM_001256959) Human Untagged Clone
SC332500

USD 850.00

5 Weeks

CLCN6 (untagged) - Homo sapiens chloride channel, voltage-sensitive 6 (CLCN6), transcript variant 2

Vector pCMV6 series
Tag Tag Free
CLCN6 ICC Control Block
TB417449

USD 1,070.00

4 Weeks

Transient overexpression of CLCN6 (NM_021737) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CLCN6 ICC Control Block
TB421261

USD 1,070.00

4 Weeks

Transient overexpression of CLCN6 (NM_021736) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CLCN6 ICC Control Block
TB421294

USD 1,070.00

4 Weeks

Transient overexpression of CLCN6 (NM_001286) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CLCN6 ICC Control Block
TB434960

USD 1,400.00

4 Weeks

Transient overexpression of CLCN6 (NM_001256959) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CLCN6 Cytosection
TS417449

USD 225.00

4 Weeks

Transient overexpression of CLCN6 (NM_021737) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CLCN6 ICC Control Sections
TS417449P5

USD 889.00

4 Weeks

Transient overexpression of CLCN6 (NM_021737) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CLCN6 Cytosection
TS421261

USD 225.00

4 Weeks

Transient overexpression of CLCN6 (NM_021736) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CLCN6 ICC Control Sections
TS421261P5

USD 889.00

4 Weeks

Transient overexpression of CLCN6 (NM_021736) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CLCN6 ICC Control Sections
TS421294P5

USD 889.00

4 Weeks

Transient overexpression of CLCN6 (NM_001286) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CLCN6 ICC Control Sections
TS434960P5

USD 889.00

4 Weeks

Transient overexpression of CLCN6 (NM_001256959) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack