Products

cDNA Clones (38)
Proteins (12)
RNAi (12)
Gene Expression (7)
Antibodies (3)
Jump to Filters
View as table Download
CLCN6 (NM_021737) Human Tagged ORF Clone
RC217449

USD 420.00

In Stock

CLCN6 (Myc-DDK-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6d

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CLCN6 (NM_001286) Human Tagged ORF Clone
RG221294

USD 460.00

In Stock

CLCN6 (GFP-tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Clcn6 (NM_011929) Mouse Tagged ORF Clone
MR224701

USD 750.00

In Stock

Clcn6 (Myc-DDK-tagged) - Mouse chloride channel 6 (Clcn6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 (NM_021736) Human Tagged ORF Clone
RC221261

USD 420.00

In Stock

CLCN6 (Myc-DDK-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6c

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 Human Gene Knockout Kit (CRISPR)
KN417449

USD 1,290.00

2 Weeks

CLCN6 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN417449 is the updated version of KN217449.
Clcn6 Mouse Gene Knockout Kit (CRISPR)
KN503396

USD 1,290.00

2 Weeks

Clcn6 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN503396 is the updated version of KN303396.
Clcn6 (NM_011929) Mouse Tagged ORF Clone
MG224701

USD 830.00

3 Weeks

Clcn6 (GFP-tagged) - Mouse chloride channel 6 (Clcn6), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Clcn6 (NM_011929) Mouse Tagged ORF Clone
MR224701L3

USD 950.00

3 Weeks

Lenti ORF clone of Clcn6 (Myc-DDK-tagged) - Mouse chloride channel 6 (Clcn6)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Clcn6 (NM_011929) Mouse Tagged ORF Clone
MR224701L4

USD 950.00

3 Weeks

Lenti ORF clone of Clcn6 (mGFP-tagged) - Mouse chloride channel 6 (Clcn6)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021737) Human Tagged ORF Clone
RC217449L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chloride channel 6 (CLCN6), transcript variant ClC-6d, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021737) Human Tagged ORF Clone Lentiviral Particle
RC217449L3V

USD 820.00

6 Weeks

Lenti ORF particles, CLCN6 (Myc-DDK tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6d, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021737) Human Tagged ORF Clone
RC217449L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chloride channel 6 (CLCN6), transcript variant ClC-6d, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021737) Human Tagged ORF Clone Lentiviral Particle
RC217449L4V

USD 820.00

6 Weeks

Lenti ORF particles, CLCN6 (mGFP-tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6d, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021736) Human Tagged ORF Clone
RC221261L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chloride channel 6 (CLCN6), transcript variant ClC-6c, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021736) Human Tagged ORF Clone Lentiviral Particle
RC221261L3V

USD 820.00

6 Weeks

Lenti ORF particles, CLCN6 (Myc-DDK tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6c, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021736) Human Tagged ORF Clone
RC221261L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chloride channel 6 (CLCN6), transcript variant ClC-6c, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_021736) Human Tagged ORF Clone Lentiviral Particle
RC221261L4V

USD 820.00

6 Weeks

Lenti ORF particles, CLCN6 (mGFP-tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6c, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_001286) Human Tagged ORF Clone
RC221294

USD 420.00

3 Weeks

CLCN6 (Myc-DDK-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 (NM_001286) Human Tagged ORF Clone
RC221294L3

USD 620.00

3 Weeks

Lenti-ORF clone of CLCN6 (Myc-DDK-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6a

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_001286) Human Tagged ORF Clone Lentiviral Particle
RC221294L3V

USD 820.00

6 Weeks

Lenti ORF particles, CLCN6 (Myc-DDK-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_001286) Human Tagged ORF Clone
RC221294L4

USD 620.00

3 Weeks

Lenti-ORF clone of CLCN6 (mGFP-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6a

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_001286) Human Tagged ORF Clone Lentiviral Particle
RC221294L4V

USD 820.00

6 Weeks

Lenti ORF particles, CLCN6 (mGFP-tagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLCN6 (NM_001256959) Human Tagged ORF Clone
RC234960

USD 750.00

5 Weeks

CLCN6 (Myc-DDK tagged) - Homo sapiens chloride channel, voltage-sensitive 6 (CLCN6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 (NM_021737) Human Tagged ORF Clone
RG217449

USD 460.00

3 Weeks

CLCN6 (GFP-tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6d

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 (NM_021736) Human Tagged ORF Clone
RG221261

USD 460.00

3 Weeks

CLCN6 (GFP-tagged) - Human chloride channel 6 (CLCN6), transcript variant ClC-6c

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CLCN6 (NM_001256959) Human Tagged ORF Clone
RG234960

USD 830.00

5 Weeks

CLCN6 (GFP-tagged) - Homo sapiens chloride channel, voltage-sensitive 6 (CLCN6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Clcn6 (NM_001106479) Rat Tagged ORF Clone
RR202682

USD 1,180.00

6 Weeks

Clcn6 (Myc-DDK-tagged ORF) - Rat chloride channel 6 (Clcn6), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Clcn6 (NM_001106479) Rat Tagged ORF Clone
RR202682L3

USD 1,360.00

11 Weeks

Lenti ORF clone of Clcn6 (Myc-DDK-tagged ORF) - Rat chloride channel 6 (Clcn6), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Clcn6 (NM_001106479) Rat Tagged ORF Clone
RR202682L4

USD 1,490.00

11 Weeks

Lenti ORF clone of Clcn6 (mGFP-tagged ORF) - Rat chloride channel 6 (Clcn6), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Clcn6 Mouse shRNA Plasmid (Locus ID 26372)
TL511007

USD 815.00

In Stock

Clcn6 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
CLCN6 (NM_021735) Human Untagged Clone
SC109072

USD 660.00

In Stock

CLCN6 (untagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6b

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CLCN6 Rabbit Polyclonal Antibody
AP01392PU-N

USD 370.00

2 Weeks

CLCN6 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
CLCN6 Rabbit Polyclonal Antibody
TA338699

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLCN6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLCN6 antibody: synthetic peptide directed towards the C terminal of human CLCN6. Synthetic peptide located within the following region: PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS
Human CLCN6 activation kit by CRISPRa
GA100847

USD 1,290.00

2 Weeks

CLCN6 CRISPRa kit - CRISPR gene activation of human chloride voltage-gated channel 6

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Clcn6 activation kit by CRISPRa
GA204928

USD 1,290.00

2 Weeks

Clcn6 CRISPRa kit - CRISPR gene activation of mouse chloride channel, voltage-sensitive 6

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
CLCN6 Human qPCR Template Standard (NM_021735)
HK210910

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene CLCN6

Application Plasmid of exact quantity for transcript copy number calculation
CLCN6 Human qPCR Primer Pair (NM_001286)
HP205202

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene CLCN6

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
CLCN6 (NM_021737) Human Over-expression Lysate
LC411931

USD 121.00

2 Weeks

CLCN6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Clcn6 (NM_011929) Mouse Untagged Clone
MC222319

USD 1,180.00

5 Weeks

Clcn6 (untagged) - Mouse chloride channel 6 (Clcn6), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Clcn6 Mouse qPCR Primer Pair (NM_011929)
MP202446

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Clcn6

Clcn6 (NM_001106479) Rat Untagged Clone
RN202682

USD 1,180.00

6 Weeks

Clcn6 (untagged ORF) - Rat chloride channel 6 (Clcn6), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CLCN6 (NM_021736) Human Untagged Clone
SC308816

USD 600.00

3 Weeks

CLCN6 (untagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6c

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CLCN6 (NM_021737) Human Untagged Clone
SC309476

USD 660.00

3 Weeks

CLCN6 (untagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6d

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CLCN6 (NM_001286) Human Untagged Clone
SC314843

USD 760.00

5 Weeks

CLCN6 (untagged)-Human chloride channel 6 (CLCN6), transcript variant ClC-6a

Vector pCMV6 series
Tag Tag Free
CLCN6 (NM_001256959) Human Untagged Clone
SC332500

USD 850.00

5 Weeks

CLCN6 (untagged) - Homo sapiens chloride channel, voltage-sensitive 6 (CLCN6), transcript variant 2

Vector pCMV6 series
Tag Tag Free