Germany
Japan
United Kingdom
China
CYP3A5 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CYP3A5 (untagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 880.00
3 Weeks
Lenti ORF particles, CYP3A5 (Myc-DDK tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 880.00
6 Weeks
Lenti ORF particles, CYP3A5 (mGFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CYP3A5 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
5 Weeks
Lenti ORF particles, CYP3A5 (Myc-DDK tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 880.00
3 Weeks
Lenti ORF particles, CYP3A5 (mGFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CYP3A5 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of CYP3A5 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, CYP3A5 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CYP3A5 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, CYP3A5 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CYP3A5 (myc-DDK-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CYP3A5 (myc-DDK-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CYP3A5 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CYP3A5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal CYP3A5 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP3A5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-502 amino acids from the C-terminal region of human CYP3A5. |
Rabbit Polyclonal Anti-CYP3A5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP3A5 antibody: synthetic peptide directed towards the N terminal of human CYP3A5. Synthetic peptide located within the following region: AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL |
USD 1,140.00
2 Weeks
Cytochrome P450 3A5 (CYP3A5) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CYP3A5 |
Transient overexpression lysate of cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CYP3A5 MS Standard C13 and N15-labeled recombinant protein (NP_000768)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CYP3A5 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CYP3A5 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CYP3A5 (untagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CYP3A5 (untagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of CYP3A5 (NM_000777) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP3A5 (NM_001190484) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP3A5 (NM_001291829) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP3A5 (NM_001291830) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP3A5 (NM_000777) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP3A5 (NM_000777) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CYP3A5 (NM_001190484) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CYP3A5 (NM_001291829) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CYP3A5 (NM_001291830) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYP3A5
Families
- P450