PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PPP3CB (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PPP3CB (mGFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PPP3CB (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, PPP3CB (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PPP3CB (mGFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PPP3CB (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP3CB (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP3CB (mGFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP3CB (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP3CB (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP3CB (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP3CB (mGFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PPP3CB (myc-DDK-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP3CB (myc-DDK-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP3CB (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP3CB (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PPP3CB (untagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PPP3CB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-Ppp3cb Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI |
Rabbit Polyclonal Anti-Ppp3cb Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS |
Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti-ORF clone of PPP3CB (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
PPP3CB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PPP3CB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform (PPP3CB), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform (PPP3CB), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-Calcineurin A antibody
Applications | WB |
Reactivities | Bovine, Hamster, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A |
Carrier-free (BSA/glycerol-free) PPP3CB mouse monoclonal antibody,clone OTI2E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression lysate of protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform (PPP3CB), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PPP3CB (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP3CB (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP3CB (untagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PPP3CB (untagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PPP3CB (untagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 5
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PPP3CB (untagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |