Products

cDNA Clones (29)
Proteins (19)
Antibodies (2)
Jump to Filters
View as table Download
SKIP (INPP5K) (NM_016532) Human Tagged ORF Clone
RC200092

USD 98.00

USD 560.00

In Stock

INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SKIP (INPP5K) (NM_130766) Human Tagged ORF Clone
RC212090

USD 420.00

In Stock

INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SKIP (INPP5K) (NM_001135642) Human Tagged ORF Clone
RC227852

USD 420.00

In Stock

INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SKIP (INPP5K) (NM_016532) Human Tagged ORF Clone Lentiviral Particle
RC200092L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, INPP5K (Myc-DDK tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SKIP (INPP5K) (NM_016532) Human Tagged ORF Clone Lentiviral Particle
RC200092L2V

USD 1,020.00

5 Weeks

Lenti ORF particles, INPP5K (mGFP-tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SKIP (INPP5K) (NM_130766) Human Tagged ORF Clone Lentiviral Particle
RC212090L1V

USD 820.00

6 Weeks

Lenti ORF particles, INPP5K (Myc-DDK tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SKIP (INPP5K) (NM_130766) Human Tagged ORF Clone Lentiviral Particle
RC212090L2V

USD 820.00

6 Weeks

Lenti ORF particles, INPP5K (mGFP-tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SKIP (INPP5K) (NM_016532) Human Tagged ORF Clone
RG200092

USD 460.00

In Stock

INPP5K (GFP-tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SKIP (INPP5K) (NM_016532) Human Tagged Lenti ORF Clone
RC200092L3

USD 768.00

3 Weeks

Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SKIP (INPP5K) (NM_016532) Human Tagged ORF Clone Lentiviral Particle
RC200092L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, INPP5K (Myc-DDK tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SKIP (INPP5K) (NM_016532) Human Tagged Lenti ORF Clone
RC200092L4

USD 768.00

3 Weeks

Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SKIP (INPP5K) (NM_016532) Human Tagged ORF Clone Lentiviral Particle
RC200092L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, INPP5K (mGFP-tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SKIP (INPP5K) (NM_130766) Human Tagged ORF Clone
RC212090L3

USD 620.00

3 Weeks

Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SKIP (INPP5K) (NM_130766) Human Tagged ORF Clone Lentiviral Particle
RC212090L3V

USD 820.00

6 Weeks

Lenti ORF particles, INPP5K (Myc-DDK tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SKIP (INPP5K) (NM_130766) Human Tagged ORF Clone
RC212090L4

USD 620.00

3 Weeks

Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SKIP (INPP5K) (NM_130766) Human Tagged ORF Clone Lentiviral Particle
RC212090L4V

USD 820.00

6 Weeks

Lenti ORF particles, INPP5K (mGFP-tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SKIP (INPP5K) (NM_001135642) Human Tagged ORF Clone
RC227852L3

USD 620.00

3 Weeks

Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SKIP (INPP5K) (NM_001135642) Human Tagged ORF Clone Lentiviral Particle
RC227852L3V

USD 820.00

6 Weeks

Lenti ORF particles, INPP5K (Myc-DDK tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SKIP (INPP5K) (NM_001135642) Human Tagged ORF Clone
RC227852L4

USD 620.00

3 Weeks

Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SKIP (INPP5K) (NM_001135642) Human Tagged ORF Clone Lentiviral Particle
RC227852L4V

USD 820.00

6 Weeks

Lenti ORF particles, INPP5K (mGFP-tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SKIP (INPP5K) (NM_130766) Human Tagged ORF Clone
RG212090

USD 460.00

3 Weeks

INPP5K (GFP-tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SKIP (INPP5K) (NM_001135642) Human Tagged ORF Clone
RG227852

USD 460.00

3 Weeks

INPP5K (GFP-tagged) - Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SKIP (INPP5K) Rabbit Polyclonal Antibody
TA343120

USD 375.00

In Stock

Rabbit Polyclonal Anti-INPP5K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF
SKIP (INPP5K) (NM_016532) Human Tagged Lenti ORF Clone
RC200092L1

USD 768.00

In Stock

Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SKIP (INPP5K) (NM_016532) Human Untagged Clone
SC321576

USD 310.00

In Stock

INPP5K (untagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SC321576 is the updated version of SC128048.
SKIP (INPP5K) (NM_016532) Human Tagged Lenti ORF Clone
RC200092L2

USD 768.00

3 Weeks

Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SKIP (INPP5K) (NM_130766) Human Tagged ORF Clone
RC212090L1

USD 620.00

3 Weeks

Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SKIP (INPP5K) (NM_130766) Human Tagged ORF Clone
RC212090L2

USD 620.00

3 Weeks

Lenti ORF clone of Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SKIP (INPP5K) (NM_016532) Human Over-expression Lysate
LY402561

USD 396.00

5 Days

Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SKIP (INPP5K) (NM_130766) Human Untagged Clone
SC108235

USD 760.00

In Stock

INPP5K (untagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SKIP (INPP5K) (NM_016532) Human Over-expression Lysate
LC402561

USD 121.00

2 Weeks

INPP5K HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SKIP (INPP5K) (NM_130766) Human Over-expression Lysate
LC408929

USD 121.00

2 Weeks

INPP5K HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SKIP (INPP5K) (NM_001135642) Human Over-expression Lysate
LC427643

USD 121.00

2 Weeks

INPP5K HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SKIP (INPP5K) (NM_130766) Human Over-expression Lysate
LY408929

USD 396.00

5 Days

Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SKIP (INPP5K) (NM_001135642) Human Over-expression Lysate
LY427643

USD 396.00

5 Days

Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SKIP (INPP5K) (NM_016532) Human Mass Spec Standard
PH300092

USD 2,055.00

3 Weeks

INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_057616)

Tag C-Myc/DDK
Expression Host HEK293
SKIP (INPP5K) (NM_130766) Human Mass Spec Standard
PH312090

USD 2,055.00

3 Weeks

INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_570122)

Tag C-Myc/DDK
Expression Host HEK293
SKIP (INPP5K) (NM_001135642) Human Mass Spec Standard
PH327852

USD 2,055.00

3 Weeks

INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_001129114)

Tag C-Myc/DDK
Expression Host HEK293
SKIP (INPP5K) (NM_001135642) Human Untagged Clone
SC325008

USD 760.00

3 Weeks

INPP5K (untagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SKIP (INPP5K) Rabbit Polyclonal Antibody
TA357804

USD 360.00

5 Days

INPP5K Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
SKIP (INPP5K) (NM_016532) ICC Control Block
TB400092

USD 1,210.00

4 Weeks

Transient overexpression of INPP5K (NM_016532) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SKIP (INPP5K) (NM_130766) ICC Control Block
TB412090

USD 1,070.00

4 Weeks

Transient overexpression of INPP5K (NM_130766) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SKIP (INPP5K) (NM_001135642) ICC Control Block
TB427852

USD 1,070.00

4 Weeks

Transient overexpression of INPP5K (NM_001135642) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SKIP (INPP5K) Cytosection
TS400092

USD 225.00

4 Weeks

Transient overexpression of INPP5K (NM_016532) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SKIP (INPP5K) Cytosection
TS400092P5

USD 889.00

4 Weeks

Transient overexpression of INPP5K (NM_016532) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SKIP (INPP5K) Cytosection
TS412090

USD 225.00

4 Weeks

Transient overexpression of INPP5K (NM_130766) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SKIP (INPP5K) Cytosection
TS412090P5

USD 889.00

4 Weeks

Transient overexpression of INPP5K (NM_130766) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SKIP (INPP5K) Cytosection
TS427852

USD 225.00

4 Weeks

Transient overexpression of INPP5K (NM_001135642) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SKIP (INPP5K) Cytosection
TS427852P5

USD 889.00

4 Weeks

Transient overexpression of INPP5K (NM_001135642) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack