Products

cDNA Clones (30)
Antibodies (26)
Proteins (23)
Jump to Filters
View as table Download
MTMR14 (NM_001077526) Human Tagged ORF Clone
RC208660

USD 420.00

In Stock

MTMR14 (Myc-DDK-tagged)-Human myotubularin related protein 14 (MTMR14), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MTMR14 (NM_001077525) Human Tagged ORF Clone
RC207732

USD 480.00

In Stock

MTMR14 (Myc-DDK-tagged)-Human myotubularin related protein 14 (MTMR14), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MTMR14 (NM_022485) Human Tagged ORF Clone
RC200809

USD 480.00

In Stock

MTMR14 (Myc-DDK-tagged)-Human myotubularin related protein 14 (MTMR14), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MTMR14 (NM_001077525) Human Tagged ORF Clone Lentiviral Particle
RC207732L1V

USD 880.00

3 Weeks

Lenti ORF particles, MTMR14 (Myc-DDK tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
MTMR14 (NM_001077525) Human Tagged ORF Clone Lentiviral Particle
RC207732L2V

USD 880.00

6 Weeks

Lenti ORF particles, MTMR14 (mGFP-tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
MTMR14 (NM_001077526) Human Tagged ORF Clone Lentiviral Particle
RC208660L1V

USD 820.00

3 Weeks

Lenti ORF particles, MTMR14 (Myc-DDK tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
MTMR14 (NM_001077526) Human Tagged ORF Clone Lentiviral Particle
RC208660L2V

USD 820.00

6 Weeks

Lenti ORF particles, MTMR14 (mGFP-tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
MTMR14 (NM_022485) Human Tagged ORF Clone
RG200809

USD 530.00

In Stock

MTMR14 (GFP-tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MTMR14 (NM_001077525) Human Tagged ORF Clone
RG207732

USD 530.00

In Stock

MTMR14 (GFP-tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MTMR14 (NM_022485) Human Tagged ORF Clone
RC200809L3

USD 680.00

3 Weeks

Lenti ORF clone of Human myotubularin related protein 14 (MTMR14), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR14 (NM_022485) Human Tagged ORF Clone Lentiviral Particle
RC200809L3V

USD 880.00

6 Weeks

Lenti ORF particles, MTMR14 (Myc-DDK tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR14 (NM_022485) Human Tagged ORF Clone
RC200809L4

USD 680.00

3 Weeks

Lenti ORF clone of Human myotubularin related protein 14 (MTMR14), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR14 (NM_022485) Human Tagged ORF Clone Lentiviral Particle
RC200809L4V

USD 880.00

6 Weeks

Lenti ORF particles, MTMR14 (mGFP-tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR14 (NM_001077525) Human Tagged ORF Clone
RC207732L3

USD 680.00

3 Weeks

Lenti ORF clone of Human myotubularin related protein 14 (MTMR14), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR14 (NM_001077525) Human Tagged ORF Clone Lentiviral Particle
RC207732L3V

USD 880.00

5 Weeks

Lenti ORF particles, MTMR14 (Myc-DDK tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR14 (NM_001077525) Human Tagged ORF Clone
RC207732L4

USD 680.00

3 Weeks

Lenti ORF clone of Human myotubularin related protein 14 (MTMR14), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR14 (NM_001077525) Human Tagged ORF Clone Lentiviral Particle
RC207732L4V

USD 880.00

7 Weeks

Lenti ORF particles, MTMR14 (mGFP-tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR14 (NM_001077526) Human Tagged ORF Clone
RC208660L3

USD 620.00

3 Weeks

Lenti ORF clone of Human myotubularin related protein 14 (MTMR14), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR14 (NM_001077526) Human Tagged ORF Clone Lentiviral Particle
RC208660L3V

USD 820.00

7 Weeks

Lenti ORF particles, MTMR14 (Myc-DDK tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR14 (NM_001077526) Human Tagged ORF Clone
RC208660L4

USD 620.00

3 Weeks

Lenti ORF clone of Human myotubularin related protein 14 (MTMR14), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR14 (NM_001077526) Human Tagged ORF Clone Lentiviral Particle
RC208660L4V

USD 820.00

7 Weeks

Lenti ORF particles, MTMR14 (mGFP-tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR14 (NM_001077526) Human Tagged ORF Clone
RG208660

USD 460.00

3 Weeks

MTMR14 (GFP-tagged) - Human myotubularin related protein 14 (MTMR14), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MTMR14 (NM_001077525) Human Tagged ORF Clone
RC207732L1

USD 840.00

In Stock

Lenti ORF clone of Human myotubularin related protein 14 (MTMR14), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
MTMR14 (NM_001077526) Human Tagged ORF Clone
RC208660L1

USD 768.00

In Stock

Lenti ORF clone of Human myotubularin related protein 14 (MTMR14), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
MTMR14 (NM_022485) Human Untagged Clone
SC112499

USD 310.00

In Stock

MTMR14 (untagged)-Human myotubularin related protein 14 (MTMR14), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
MTMR14 Rabbit Polyclonal Antibody
TA344677

USD 475.00

5 Days

Rabbit Polyclonal Anti-MTMR14 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTMR14 antibody: synthetic peptide directed towards the middle region of human MTMR14. Synthetic peptide located within the following region: NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS
MTMR14 (NM_001077525) Human Tagged ORF Clone
RC207732L2

USD 680.00

3 Weeks

Lenti ORF clone of Human myotubularin related protein 14 (MTMR14), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MTMR14 (NM_001077526) Human Tagged ORF Clone
RC208660L2

USD 620.00

3 Weeks

Lenti ORF clone of Human myotubularin related protein 14 (MTMR14), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MTMR14 (NM_001077525) Human Over-expression Lysate
LC421457

USD 121.00

In Stock

MTMR14 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MTMR14 (NM_022485) Human Over-expression Lysate
LY411652

USD 396.00

5 Days

Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MTMR14 Mouse Monoclonal Antibody [Clone ID: OTI6F8]
CF501607

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MTMR14 mouse monoclonal antibody, clone OTI6F8 (formerly 6F8)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MTMR14 Mouse Monoclonal Antibody [Clone ID: OTI9G9]
CF501712

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MTMR14 mouse monoclonal antibody, clone OTI9G9 (formerly 9G9)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MTMR14 Mouse Monoclonal Antibody [Clone ID: OTI7B2]
CF501737

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MTMR14 mouse monoclonal antibody, clone OTI7B2 (formerly 7B2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MTMR14 Mouse Monoclonal Antibody [Clone ID: OTI7F2]
CF501738

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MTMR14 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MTMR14 Mouse Monoclonal Antibody [Clone ID: OTI6B6]
CF501774

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MTMR14 mouse monoclonal antibody, clone OTI6B6 (formerly 6B6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
MTMR14 (NM_022485) Human Over-expression Lysate
LC411652

USD 121.00

2 Weeks

MTMR14 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MTMR14 (NM_001077526) Human Over-expression Lysate
LC421458

USD 121.00

2 Weeks

MTMR14 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MTMR14 (NM_001077526) Human Over-expression Lysate
LC425875

USD 121.00

2 Weeks

MTMR14 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MTMR14 (NM_001077525) Human Over-expression Lysate
LY421457

USD 396.00

5 Days

Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MTMR14 (NM_001077526) Human Over-expression Lysate
LY421458

USD 396.00

5 Days

Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY421458 is the same product as LY425875.
MTMR14 (NM_001077526) Human Over-expression Lysate
LY425875

USD 396.00

5 Days

Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MTMR14 (NM_022485) Human Mass Spec Standard
PH300809

USD 2,055.00

3 Weeks

MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_071930)

Tag C-Myc/DDK
Expression Host HEK293
MTMR14 (NM_001077525) Human Mass Spec Standard
PH307732

USD 2,055.00

3 Weeks

MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070993)

Tag C-Myc/DDK
Expression Host HEK293
MTMR14 (NM_001077526) Human Mass Spec Standard
PH308660

USD 2,055.00

3 Weeks

MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070994)

Tag C-Myc/DDK
Expression Host HEK293
MTMR14 (NM_001077526) Human Untagged Clone
SC315595

USD 760.00

3 Weeks

MTMR14 (untagged)-Human myotubularin related protein 14 (MTMR14), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
MTMR14 (NM_001077525) Human Untagged Clone
SC315601

USD 760.00

3 Weeks

MTMR14 (untagged)-Human myotubularin related protein 14 (MTMR14), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
MTMR14 (NM_022485) Human Untagged Clone
SC317910

USD 760.00

3 Weeks

MTMR14 (untagged)-Human myotubularin related protein 14 (MTMR14), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin