Products

cDNA Clones (11)
Antibodies (7)
Proteins (5)
Jump to Filters
View as table Download
Cathepsin K (CTSK) (NM_000396) Human Tagged ORF Clone
RC204892

USD 420.00

In Stock

CTSK (Myc-DDK-tagged)-Human cathepsin K (CTSK)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Cathepsin K (CTSK) (NM_000396) Human Tagged ORF Clone
RG204892

USD 460.00

In Stock

CTSK (GFP-tagged) - Human cathepsin K (CTSK)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cathepsin K (CTSK) (NM_000396) Human Untagged Clone
SC119901

USD 310.00

In Stock

CTSK (untagged)-Human cathepsin K (CTSK)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Cathepsin K (CTSK) Rabbit Polyclonal Antibody
TA318059

USD 580.00

2 Weeks

Cathepsin K Rabbit anti-Rat Polyclonal Antibody

Applications IHC
Reactivities Chicken, Human, Mouse, Rabbit, Rat, Pig
Conjugation Unconjugated
Immunogen CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K.
Cathepsin K (CTSK) (NM_000396) Human Over-expression Lysate
LY424745

USD 396.00

5 Days

Transient overexpression lysate of cathepsin K (CTSK)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cathepsin K (CTSK) Rabbit Polyclonal Antibody
TA318065

USD 540.00

In Stock

Cathepsin K Rabbit anti-Rat Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K.
Cathepsin K (CTSK) Rabbit Polyclonal Antibody
AP17260PU-N

USD 450.00

2 Weeks

Cathepsin K (CTSK) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Bovine, Human, Monkey, Porcine, Rabbit
Immunogen KLH conjugated synthetic peptide between aa 207-27 from the Center region of human CTSK.
Cathepsin K (CTSK) (Center) Rabbit Polyclonal Antibody
AP51131PU-N

USD 450.00

2 Weeks

Cathepsin K (CTSK) (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 96-126 amino acids from the Central region of Human Cathepsin K
Cathepsin K (CTSK) (NM_000396) Human Over-expression Lysate
LC424745

USD 121.00

In Stock

CTSK HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cathepsin K (CTSK) (NM_000396) Human Tagged ORF Clone
RC204892L2

USD 620.00

3 Weeks

Lenti ORF clone of Human cathepsin K (CTSK), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Cathepsin K (CTSK) (NM_000396) Human Untagged Clone
SC319622

USD 660.00

In Stock

CTSK (untagged)-Human cathepsin K (CTSK)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Cathepsin K (CTSK) Goat Polyclonal Antibody
TA303361

USD 375.00

5 Days

Goat Polyclonal Antibody against CTSK

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KTHRKQYNNKVDE, from the internal region (near N-terminus) of the protein sequence according to NP_000387.1.
Cathepsin K (CTSK) Rabbit Polyclonal Antibody
TA343087

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTSK Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CTSK antibody: synthetic peptide directed towards the middle region of human CTSK. Synthetic peptide located within the following region: SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY
Cathepsin K (CTSK) Rabbit Polyclonal Antibody
TA352001

USD 345.00

In Stock

Rabbit Polyclonal Anti-CTSK Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CTSK
Cathepsin K (CTSK) ICC Control Block
TB404892

USD 1,070.00

4 Weeks

Transient overexpression of CTSK (NM_000396) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cathepsin K (CTSK) Cytosection
TS404892

USD 225.00

4 Weeks

Transient overexpression of CTSK (NM_000396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Cathepsin K (CTSK) Cytosection
TS404892P5

USD 889.00

4 Weeks

Transient overexpression of CTSK (NM_000396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack