Products

cDNA Clones (19)
Proteins (14)
Antibodies (8)
Jump to Filters
View as table Download
Kallikrein 2 (KLK2) (NM_005551) Human Tagged ORF Clone
RC202667

USD 98.00

USD 390.00

In Stock

KLK2 (Myc-DDK-tagged)-Human kallikrein-related peptidase 2 (KLK2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Kallikrein 2 (KLK2) (NM_001002231) Human Tagged ORF Clone
RC223935

USD 420.00

In Stock

KLK2 (Myc-DDK-tagged)-Human kallikrein-related peptidase 2 (KLK2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Kallikrein 2 (KLK2) (NM_005551) Human Tagged ORF Clone
RC202667L3

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 2 (KLK2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 2 (KLK2) (NM_005551) Human Tagged ORF Clone Lentiviral Particle
RC202667L3V

USD 820.00

7 Weeks

Lenti ORF particles, KLK2 (Myc-DDK tagged) - Human kallikrein-related peptidase 2 (KLK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 2 (KLK2) (NM_005551) Human Tagged ORF Clone
RC202667L4

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 2 (KLK2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 2 (KLK2) (NM_005551) Human Tagged ORF Clone Lentiviral Particle
RC202667L4V

USD 820.00

7 Weeks

Lenti ORF particles, KLK2 (mGFP-tagged) - Human kallikrein-related peptidase 2 (KLK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 2 (KLK2) (NM_001002231) Human Tagged ORF Clone
RC223935L3

USD 620.00

3 Weeks

Lenti-ORF clone of KLK2 (Myc-DDK-tagged)-Human kallikrein-related peptidase 2 (KLK2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 2 (KLK2) (NM_001002231) Human Tagged ORF Clone Lentiviral Particle
RC223935L3V

USD 820.00

6 Weeks

Lenti ORF particles, KLK2 (Myc-DDK-tagged)-Human kallikrein-related peptidase 2 (KLK2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 2 (KLK2) (NM_001002231) Human Tagged ORF Clone
RC223935L4

USD 620.00

3 Weeks

Lenti-ORF clone of KLK2 (mGFP-tagged)-Human kallikrein-related peptidase 2 (KLK2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 2 (KLK2) (NM_001002231) Human Tagged ORF Clone Lentiviral Particle
RC223935L4V

USD 820.00

6 Weeks

Lenti ORF particles, KLK2 (mGFP-tagged)-Human kallikrein-related peptidase 2 (KLK2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 2 (KLK2) (NM_001256080) Human Tagged ORF Clone
RC231900

USD 420.00

3 Weeks

KLK2 (Myc-DDK tagged) - Homo sapiens kallikrein-related peptidase 2 (KLK2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Kallikrein 2 (KLK2) (NM_005551) Human Tagged ORF Clone
RG202667

USD 460.00

3 Weeks

KLK2 (GFP-tagged) - Human kallikrein-related peptidase 2 (KLK2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kallikrein 2 (KLK2) (NM_001002231) Human Tagged ORF Clone
RG223935

USD 460.00

3 Weeks

KLK2 (GFP-tagged) - Human kallikrein-related peptidase 2 (KLK2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kallikrein 2 (KLK2) (NM_001256080) Human Tagged ORF Clone
RG231900

USD 460.00

3 Weeks

KLK2 (GFP-tagged) - Homo sapiens kallikrein-related peptidase 2 (KLK2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kallikrein 2 (KLK2) (NM_005551) Human Over-expression Lysate
LY417229

USD 396.00

In Stock

Transient overexpression lysate of kallikrein-related peptidase 2 (KLK2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 2 (KLK2) (NM_005551) Human Untagged Clone
SC110938

USD 310.00

In Stock

KLK2 (untagged)-Human kallikrein-related peptidase 2 (KLK2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Kallikrein 2 (KLK2) (NM_001002231) Human Untagged Clone
SC300404

USD 420.00

In Stock

KLK2 (untagged)-Human kallikrein-related peptidase 2 (KLK2), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Kallikrein 2 (KLK2) Rabbit Polyclonal Antibody
TA346241

USD 475.00

5 Days

Rabbit Polyclonal Anti-KLK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLK2 antibody: synthetic peptide directed towards the middle region of human KLK2. Synthetic peptide located within the following region: KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG
Kallikrein 2 (KLK2) (NM_005551) Human Over-expression Lysate
LC417229

USD 121.00

In Stock

KLK2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 2 (KLK2) (NM_001256080) Human Untagged Clone
SC330358

USD 310.00

3 Weeks

KLK2 (untagged) - Homo sapiens kallikrein-related peptidase 2 (KLK2), transcript variant 3

Vector pCMV6 series
Tag Tag Free
Kallikrein 2 (KLK2) Goat Polyclonal Antibody
TA303201

USD 375.00

5 Days

Goat Polyclonal Antibody against KLK2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KHQSLRPDEDSSHD, from the internal region of the protein sequence according to NP_005542.1; NP_001002231.1.
KLK2 / Kallikrein-2 (25-261, His-tag) Human Protein
AR50999PU-N

USD 845.00

2 Weeks

KLK2 / Kallikrein-2 (25-261, His-tag) human protein, 0.5 mg

Tag His-tag
Expression Host E. coli
KLK2 / Kallikrein-2 (25-261, His-tag) Human Protein
AR50999PU-S

USD 330.00

2 Weeks

KLK2 / Kallikrein-2 (25-261, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Kallikrein 2 (KLK2) Mouse Monoclonal Antibody [Clone ID: OTI5D6]
CF802077

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KLK2 mouse monoclonal antibody, clone OTI5D6 (formerly 5D6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Kallikrein 2 (KLK2) (NM_005551) Human Mass Spec Standard
PH302667

USD 2,055.00

3 Weeks

KLK2 MS Standard C13 and N15-labeled recombinant protein (NP_005542)

Tag C-Myc/DDK
Expression Host HEK293
Kallikrein 2 (KLK2) Rabbit Polyclonal Antibody
TA322585

USD 345.00

4 Weeks

Anti-KLK2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 235-246 amino acids of Human kallikrein-related peptidase 2
Kallikrein 2 (KLK2) ICC Control Block
TB402667

USD 1,040.00

4 Weeks

Transient overexpression of KLK2 (NM_005551) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Kallikrein 2 (KLK2) ICC Control Block
TB423935

USD 1,070.00

4 Weeks

Transient overexpression of KLK2 (NM_001002231) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Kallikrein 2 (KLK2) ICC Control Block
TB431900

USD 1,070.00

4 Weeks

Transient overexpression of KLK2 (NM_001256080) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Kallikrein 2 (KLK2) Cytosection
TS402667

USD 225.00

4 Weeks

Transient overexpression of KLK2 (NM_005551) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Kallikrein 2 (KLK2) Cytosection
TS402667P5

USD 889.00

4 Weeks

Transient overexpression of KLK2 (NM_005551) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Kallikrein 2 (KLK2) Cytosection
TS423935

USD 225.00

4 Weeks

Transient overexpression of KLK2 (NM_001002231) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Kallikrein 2 (KLK2) Cytosection
TS423935P5

USD 889.00

4 Weeks

Transient overexpression of KLK2 (NM_001002231) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Kallikrein 2 (KLK2) ICC Control Sections
TS431900P5

USD 889.00

4 Weeks

Transient overexpression of KLK2 (NM_001256080) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack