Products

cDNA Clones (32)
Proteins (21)
Antibodies (4)
Jump to Filters
View as table Download
Kallikrein 5 (KLK5) (NM_001077492) Human Tagged ORF Clone
RC200192

USD 98.00

USD 470.00

In Stock

KLK5 (Myc-DDK-tagged)-Human kallikrein-related peptidase 5 (KLK5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Kallikrein 5 (KLK5) (NM_012427) Human Tagged ORF Clone
RC224554

USD 420.00

In Stock

KLK5 (Myc-DDK-tagged)-Human kallikrein-related peptidase 5 (KLK5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Kallikrein 5 (KLK5) (NM_001077492) Human Tagged ORF Clone Lentiviral Particle
RC200192L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, KLK5 (Myc-DDK tagged) - Human kallikrein-related peptidase 5 (KLK5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Kallikrein 5 (KLK5) (NM_001077491) Human Tagged ORF Clone
RG217479

USD 460.00

In Stock

KLK5 (GFP-tagged) - Human kallikrein-related peptidase 5 (KLK5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kallikrein 5 (KLK5) (NM_012427) Human Tagged ORF Clone
RG224554

USD 460.00

In Stock

KLK5 (GFP-tagged) - Human kallikrein-related peptidase 5 (KLK5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kallikrein 5 (KLK5) (NM_001077492) Human Tagged ORF Clone Lentiviral Particle
RC200192L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, KLK5 (Myc-DDK tagged) - Human kallikrein-related peptidase 5 (KLK5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 5 (KLK5) (NM_001077492) Human Tagged ORF Clone Lentiviral Particle
RC200192L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, KLK5 (mGFP-tagged) - Human kallikrein-related peptidase 5 (KLK5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 5 (KLK5) (NM_001077491) Human Tagged ORF Clone
RC217479L3

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 5 (KLK5), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 5 (KLK5) (NM_001077491) Human Tagged ORF Clone Lentiviral Particle
RC217479L3V

USD 820.00

5 Weeks

Lenti ORF particles, KLK5 (Myc-DDK tagged) - Human kallikrein-related peptidase 5 (KLK5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 5 (KLK5) (NM_001077491) Human Tagged ORF Clone
RC217479L4

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 5 (KLK5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 5 (KLK5) (NM_001077491) Human Tagged ORF Clone Lentiviral Particle
RC217479L4V

USD 820.00

7 Weeks

Lenti ORF particles, KLK5 (mGFP-tagged) - Human kallikrein-related peptidase 5 (KLK5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 5 (KLK5) (NM_012427) Human Tagged ORF Clone
RC224554L3

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 5 (KLK5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 5 (KLK5) (NM_012427) Human Tagged ORF Clone Lentiviral Particle
RC224554L3V

USD 820.00

6 Weeks

Lenti ORF particles, KLK5 (Myc-DDK tagged) - Human kallikrein-related peptidase 5 (KLK5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 5 (KLK5) (NM_012427) Human Tagged ORF Clone
RC224554L4

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 5 (KLK5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 5 (KLK5) (NM_012427) Human Tagged ORF Clone Lentiviral Particle
RC224554L4V

USD 820.00

6 Weeks

Lenti ORF particles, KLK5 (mGFP-tagged) - Human kallikrein-related peptidase 5 (KLK5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 5 (KLK5) (NM_001077492) Human Tagged ORF Clone
RG200192

USD 460.00

3 Weeks

KLK5 (GFP-tagged) - Human kallikrein-related peptidase 5 (KLK5), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kallikrein 5 (KLK5) (NM_012427) Human Untagged Clone
SC123732

USD 310.00

In Stock

KLK5 (untagged)-Human kallikrein-related peptidase 5 (KLK5), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Kallikrein 5 (KLK5) (NM_012427) Human Over-expression Lysate
LY402213

USD 396.00

In Stock

Transient overexpression lysate of kallikrein-related peptidase 5 (KLK5), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 5 (KLK5) (NM_001077492) Human Tagged Lenti ORF Clone
RC200192L1

USD 768.00

In Stock

Lenti ORF clone of Human kallikrein-related peptidase 5 (KLK5), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Kallikrein 5 (KLK5) (NM_001077492) Human Tagged Lenti ORF Clone
RC200192L2

USD 768.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 5 (KLK5), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Kallikrein 5 (KLK5) (NM_001077491) Human Tagged ORF Clone
RC217479L2

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 5 (KLK5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Kallikrein 5 (KLK5) (NM_012427) Human Tagged ORF Clone
RC224554L1

USD 620.00

In Stock

Lenti ORF clone of Human kallikrein-related peptidase 5 (KLK5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Kallikrein 5 (KLK5) (NM_012427) Human Tagged ORF Clone
RC224554L2

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 5 (KLK5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Kallikrein 5 (KLK5) (NM_012427) Human Over-expression Lysate
LC402213

USD 121.00

In Stock

KLK5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 5 (KLK5) (NM_001077491) Human Over-expression Lysate
LC421442

USD 121.00

In Stock

KLK5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 5 (KLK5) (NM_001077492) Human Over-expression Lysate
LC425869

USD 121.00

In Stock

KLK5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 5 (KLK5) (NM_001077491) Human Over-expression Lysate
LY421442

USD 396.00

In Stock

Transient overexpression lysate of kallikrein-related peptidase 5 (KLK5), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 5 (KLK5) (NM_001077492) Human Over-expression Lysate
LY425869

USD 396.00

In Stock

Transient overexpression lysate of kallikrein-related peptidase 5 (KLK5), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 5 (KLK5) Goat Polyclonal Antibody
TA303202

USD 375.00

5 Days

Goat Polyclonal Antibody against KLK5

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KAGRDSCQGD, from the internal region of the protein sequence according to NP_036559.1; NP_001070959.1; NP_001070960.1.
Kallikrein 5 (KLK5) Rabbit Polyclonal Antibody
TA309721

USD 350.00

5 Days

Rabbit Polyclonal Kallikrein 5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Residues 280-293 [KFTKWIQETIQANS] of the human KLK-L2 protein.
Kallikrein 5 (KLK5) Rabbit Polyclonal Antibody
TA335939

USD 375.00

5 Days

Rabbit Polyclonal Anti-KLK5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KLK5 Antibody: synthetic peptide directed towards the N terminal of human KLK5. Synthetic peptide located within the following region: CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAAL
KLK5 / Kallikrein-5 (67-293, His-tag) Human Protein
AR50450PU-N

USD 845.00

2 Weeks

KLK5 / Kallikrein-5 (67-293, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
KLK5 / Kallikrein-5 (67-293, His-tag) Human Protein
AR50450PU-S

USD 330.00

2 Weeks

KLK5 / Kallikrein-5 (67-293, His-tag) human protein, 20 µg

Tag His-tag
Expression Host E. coli
Kallikrein 5 (KLK5) (NM_001077492) Human Over-expression Lysate
LC421443

USD 121.00

2 Weeks

KLK5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 5 (KLK5) (NM_001077492) Human Over-expression Lysate
LY421443

USD 396.00

5 Days

Transient overexpression lysate of kallikrein-related peptidase 5 (KLK5), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY421443 is the same product as LY425869.
Kallikrein 5 (KLK5) (NM_001077491) Human Mass Spec Standard
PH317479

USD 2,055.00

3 Weeks

KLK5 MS Standard C13 and N15-labeled recombinant protein (NP_001070959)

Tag C-Myc/DDK
Expression Host HEK293
Kallikrein 5 (KLK5) (NM_001077491) Human Untagged Clone
SC315511

USD 660.00

3 Weeks

KLK5 (untagged)-Human kallikrein-related peptidase 5 (KLK5), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Kallikrein 5 (KLK5) (NM_001077492) Human Untagged Clone
SC315512

USD 660.00

3 Weeks

KLK5 (untagged)-Human kallikrein-related peptidase 5 (KLK5), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Kallikrein 5 (KLK5) Rabbit Polyclonal Antibody
TA321822

USD 345.00

In Stock

Anti-KLK5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 279-293 amino acids of Human kallikrein-related peptidase 5
Kallikrein 5 (KLK5) (NM_001077492) ICC Control Block
TB400192

USD 1,120.00

4 Weeks

Transient overexpression of KLK5 (NM_001077492) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Kallikrein 5 (KLK5) (NM_001077491) ICC Control Block
TB417479

USD 1,070.00

4 Weeks

Transient overexpression of KLK5 (NM_001077491) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Kallikrein 5 (KLK5) (NM_012427) ICC Control Block
TB424554

USD 1,070.00

4 Weeks

Transient overexpression of KLK5 (NM_012427) in HEK293T cells paraffin embedded controls for ICC/IHC staining