Products

cDNA Clones (31)
Proteins (26)
Antibodies (5)
Jump to Filters
View as table Download
Kallikrein 6 (KLK6) (NM_001012964) Human Tagged ORF Clone
RG202146

USD 460.00

In Stock

KLK6 (GFP-tagged) - Human kallikrein-related peptidase 6 (KLK6), transcript variant B

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kallikrein 6 (KLK6) (NM_002774) Human Tagged ORF Clone
RG218647

USD 460.00

In Stock

KLK6 (GFP-tagged) - Human kallikrein-related peptidase 6 (KLK6), transcript variant A

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kallikrein 6 (KLK6) (NM_001012964) Human Tagged ORF Clone
RC202146L3

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 6 (KLK6), transcript variant B, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 6 (KLK6) (NM_001012964) Human Tagged ORF Clone Lentiviral Particle
RC202146L3V

USD 820.00

5 Weeks

Lenti ORF particles, KLK6 (Myc-DDK tagged) - Human kallikrein-related peptidase 6 (KLK6), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 6 (KLK6) (NM_001012964) Human Tagged ORF Clone Lentiviral Particle
RC202146L4V

USD 820.00

3 Weeks

Lenti ORF particles, KLK6 (mGFP-tagged) - Human kallikrein-related peptidase 6 (KLK6), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 6 (KLK6) (NM_002774) Human Tagged ORF Clone
RC218647L3

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 6 (KLK6), transcript variant A, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 6 (KLK6) (NM_002774) Human Tagged ORF Clone Lentiviral Particle
RC218647L3V

USD 820.00

6 Weeks

Lenti ORF particles, KLK6 (Myc-DDK tagged) - Human kallikrein-related peptidase 6 (KLK6), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 6 (KLK6) (NM_002774) Human Tagged ORF Clone
RC218647L4

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 6 (KLK6), transcript variant A, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 6 (KLK6) (NM_002774) Human Tagged ORF Clone Lentiviral Particle
RC218647L4V

USD 820.00

6 Weeks

Lenti ORF particles, KLK6 (mGFP-tagged) - Human kallikrein-related peptidase 6 (KLK6), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 6 (KLK6) (NM_001012965) Human Tagged ORF Clone
RC221436L3

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 6 (KLK6), transcript variant C, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 6 (KLK6) (NM_001012965) Human Tagged ORF Clone Lentiviral Particle
RC221436L3V

USD 820.00

7 Weeks

Lenti ORF particles, KLK6 (Myc-DDK tagged) - Human kallikrein-related peptidase 6 (KLK6), transcript variant C, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 6 (KLK6) (NM_001012965) Human Tagged ORF Clone
RC221436L4

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 6 (KLK6), transcript variant C, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 6 (KLK6) (NM_001012965) Human Tagged ORF Clone Lentiviral Particle
RC221436L4V

USD 820.00

7 Weeks

Lenti ORF particles, KLK6 (mGFP-tagged) - Human kallikrein-related peptidase 6 (KLK6), transcript variant C, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kallikrein 6 (KLK6) (NM_001012965) Human Tagged ORF Clone
RG221436

USD 460.00

3 Weeks

KLK6 (GFP-tagged) - Human kallikrein-related peptidase 6 (KLK6), transcript variant C

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kallikrein 6 (KLK6) (NM_002774) Human Untagged Clone
SC118402

USD 310.00

In Stock

KLK6 (untagged)-Human kallikrein-related peptidase 6 (KLK6), transcript variant A

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Kallikrein 6 (KLK6) (NM_002774) Human Over-expression Lysate
LY400982

USD 396.00

In Stock

Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant A

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 6 (KLK6) Rabbit Polyclonal Antibody
TA324832

USD 450.00

5 Days

Rabbit polyclonal Kallikrein 6 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Kallikrein 6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Kallikrein 6.
Kallikrein 6 (KLK6) (NM_001012964) Human Over-expression Lysate
LY422842

USD 396.00

In Stock

Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant B

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 6 (KLK6) (NM_001012964) Human Tagged ORF Clone
RC202146L2

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 6 (KLK6), transcript variant B, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Kallikrein 6 (KLK6) (NM_002774) Human Tagged ORF Clone
RC218647L1

USD 620.00

In Stock

Lenti ORF clone of Human kallikrein-related peptidase 6 (KLK6), transcript variant A, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Kallikrein 6 (KLK6) (NM_002774) Human Tagged ORF Clone
RC218647L2

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 6 (KLK6), transcript variant A, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Kallikrein 6 (KLK6) (NM_001012965) Human Tagged ORF Clone
RC221436L2

USD 620.00

3 Weeks

Lenti ORF clone of Human kallikrein-related peptidase 6 (KLK6), transcript variant C, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Kallikrein 6 (KLK6) Rabbit Polyclonal Antibody
TA324833

USD 450.00

5 Days

Rabbit polyclonal Kallikrein 6 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Kallikrein 6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 126-156 amino acids from the Central region of human Kallikrein 6.
Kallikrein 6 (KLK6) (NM_002774) Human Over-expression Lysate
LC400982

USD 121.00

In Stock

KLK6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Kallikrein 6 (KLK6) (NM_001012964) Human Over-expression Lysate
LC422842

USD 121.00

In Stock

KLK6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 6 (KLK6) (NM_001012964) Human Untagged Clone
SC322327

USD 420.00

In Stock

KLK6 (untagged)-Human kallikrein-related peptidase 6 (KLK6), transcript variant B

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Kallikrein 6 (KLK6) Rabbit Polyclonal Antibody
TA334684

USD 375.00

5 Days

Rabbit Polyclonal Anti-KLK6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLK6 antibody: synthetic peptide directed towards the N terminal of human KLK6. Synthetic peptide located within the following region: KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ
Kallikrein 6 (KLK6) Rabbit Polyclonal Antibody
TA309722

USD 424.00

5 Days

Rabbit Polyclonal Kallikrein 6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length human KLK6 protein [Swiss-Prot# Q92876] expressed in E. coli.
Kallikrein 6 (KLK6) (NM_001012965) Human Over-expression Lysate
LC422843

USD 121.00

2 Weeks

KLK6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 6 (KLK6) (NM_001012965) Human Over-expression Lysate
LC425340

USD 121.00

2 Weeks

KLK6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 6 (KLK6) (NM_001012965) Human Over-expression Lysate
LY422843

USD 396.00

5 Days

Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant C

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY422843 is the same product as LY425340.
Kallikrein 6 (KLK6) (NM_001012965) Human Over-expression Lysate
LY425340

USD 396.00

5 Days

Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant C

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kallikrein 6 (KLK6) (NM_001012964) Human Mass Spec Standard
PH302146

USD 2,055.00

3 Weeks

KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_001012982)

Tag C-Myc/DDK
Expression Host HEK293
Kallikrein 6 (KLK6) (NM_002774) Human Mass Spec Standard
PH318647

USD 2,055.00

3 Weeks

KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_002765)

Tag C-Myc/DDK
Expression Host HEK293
Kallikrein 6 (KLK6) (NM_001012965) Human Mass Spec Standard
PH321436

USD 2,055.00

3 Weeks

KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_001012983)

Tag C-Myc/DDK
Expression Host HEK293
Kallikrein 6 (KLK6) (NM_001012965) Human Untagged Clone
SC301735

USD 420.00

3 Weeks

KLK6 (untagged)-Human kallikrein-related peptidase 6 (KLK6), transcript variant C

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Kallikrein 6 (KLK6) Rabbit Polyclonal Antibody
TA350122

USD 345.00

In Stock

Rabbit Polyclonal Anti-KLK6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human KLK6
Kallikrein 6 (KLK6) ICC Control Block
TB402146

USD 1,040.00

4 Weeks

Transient overexpression of KLK6 (NM_001012964) in HEK293T cells paraffin embedded controls for ICC/IHC staining