Products

Proteins (23)
cDNA Clones (23)
Antibodies (12)
Jump to Filters
View as table Download
PEPD (NM_000285) Human Tagged ORF Clone
RC201970

USD 420.00

In Stock

PEPD (Myc-DDK-tagged)-Human peptidase D (PEPD), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PEPD (NM_001166057) Human Tagged ORF Clone
RC228345

USD 420.00

In Stock

PEPD (Myc-DDK-tagged)-Human peptidase D (PEPD), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PEPD (NM_001166056) Human Tagged ORF Clone
RC228366

USD 420.00

In Stock

PEPD (Myc-DDK-tagged)-Human peptidase D (PEPD), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PEPD (NM_000285) Human Tagged ORF Clone
RG201970

USD 460.00

In Stock

PEPD (GFP-tagged) - Human peptidase D (PEPD), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PEPD (NM_000285) Human Tagged ORF Clone
RC201970L3

USD 620.00

3 Weeks

Lenti ORF clone of Human peptidase D (PEPD), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PEPD (NM_000285) Human Tagged ORF Clone Lentiviral Particle
RC201970L3V

USD 820.00

6 Weeks

Lenti ORF particles, PEPD (Myc-DDK tagged) - Human peptidase D (PEPD), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PEPD (NM_000285) Human Tagged ORF Clone
RC201970L4

USD 620.00

3 Weeks

Lenti ORF clone of Human peptidase D (PEPD), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PEPD (NM_000285) Human Tagged ORF Clone Lentiviral Particle
RC201970L4V

USD 820.00

6 Weeks

Lenti ORF particles, PEPD (mGFP-tagged) - Human peptidase D (PEPD), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PEPD (NM_001166057) Human Tagged ORF Clone
RC228345L3

USD 620.00

3 Weeks

Lenti ORF clone of Human peptidase D (PEPD), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PEPD (NM_001166057) Human Tagged ORF Clone
RC228345L4

USD 620.00

3 Weeks

Lenti ORF clone of Human peptidase D (PEPD), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PEPD (NM_001166056) Human Tagged ORF Clone
RC228366L3

USD 620.00

3 Weeks

Lenti ORF clone of Human peptidase D (PEPD), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PEPD (NM_001166056) Human Tagged ORF Clone
RC228366L4

USD 620.00

3 Weeks

Lenti ORF clone of Human peptidase D (PEPD), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PEPD (NM_001166057) Human Tagged ORF Clone
RG228345

USD 460.00

3 Weeks

PEPD (GFP-tagged) - Human peptidase D (PEPD), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PEPD (NM_001166056) Human Tagged ORF Clone
RG228366

USD 460.00

3 Weeks

PEPD (GFP-tagged) - Human peptidase D (PEPD), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PEPD (NM_000285) Human Untagged Clone
SC119982

USD 310.00

In Stock

PEPD (untagged)-Human peptidase D (PEPD), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PEPD (NM_000285) Human Untagged Clone
SC322376

USD 310.00

In Stock

PEPD (untagged)-Human peptidase D (PEPD), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PEPD Rabbit Polyclonal Antibody
TA332680

USD 275.00

3 Weeks

Rabbit anti-PEPD Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PEPD
PEPD (NM_000285) Human Over-expression Lysate
LC424818

USD 121.00

In Stock

PEPD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PEPD (NM_001166056) Human Over-expression Lysate
LY431394

USD 396.00

In Stock

Transient overexpression lysate of peptidase D (PEPD), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PEPD Rabbit Polyclonal Antibody
TA335138

USD 375.00

5 Days

Rabbit polyclonal Anti-PEPD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PEPD antibody: synthetic peptide directed towards the middle region of human PEPD. Synthetic peptide located within the following region: LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV
Peptidase D / PEPD (1-493, His-tag) Human Protein
AR51800PU-N

USD 845.00

2 Weeks

Peptidase D / PEPD (1-493, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Peptidase D / PEPD (1-493, His-tag) Human Protein
AR51800PU-S

USD 330.00

2 Weeks

Peptidase D / PEPD (1-493, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
PEPD Mouse Monoclonal Antibody [Clone ID: OTI5D5]
CF501655

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PEPD mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PEPD Mouse Monoclonal Antibody [Clone ID: OTI1B7]
CF501727

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PEPD mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PEPD (NM_001166057) Human Over-expression Lysate
LC431373

USD 121.00

2 Weeks

PEPD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PEPD (NM_001166056) Human Over-expression Lysate
LC431394

USD 121.00

2 Weeks

PEPD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PEPD (NM_000285) Human Over-expression Lysate
LY424818

USD 396.00

5 Days

Transient overexpression lysate of peptidase D (PEPD), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PEPD (NM_001166057) Human Over-expression Lysate
LY431373

USD 396.00

5 Days

Transient overexpression lysate of peptidase D (PEPD), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PEPD (NM_000285) Human Mass Spec Standard
PH301970

USD 2,055.00

3 Weeks

PEPD MS Standard C13 and N15-labeled recombinant protein (NP_000276)

Tag C-Myc/DDK
Expression Host HEK293
PEPD (BC028295) Human Untagged Clone
SC126231

USD 310.00

3 Weeks

PEPD (untagged)-Human peptidase D, mRNA (cDNA clone MGC:24893 IMAGE:4470066), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PEPD (NM_001166057) Human Untagged Clone
SC326980

USD 730.00

3 Weeks

PEPD (untagged)-Human peptidase D (PEPD) transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PEPD (NM_001166056) Human Untagged Clone
SC327001

USD 760.00

3 Weeks

PEPD (untagged)-Human peptidase D (PEPD) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PEPD Mouse Monoclonal Antibody [Clone ID: OTI5D5]
TA501655

USD 379.00

In Stock

PEPD mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PEPD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D5]
TA501655AM

USD 420.00

4 Weeks

PEPD mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
PEPD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D5]
TA501655BM

USD 420.00

4 Weeks

PEPD mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
PEPD Mouse Monoclonal Antibody [Clone ID: OTI5D5]
TA501655S

USD 159.00

2 Days

PEPD mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PEPD Mouse Monoclonal Antibody [Clone ID: OTI1B7]
TA501727

USD 379.00

In Stock

Anti-PEPD mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PEPD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B7]
TA501727AM

USD 420.00

4 Weeks

Anti-PEPD mouse monoclonal antibody, clone OTI1B7 (formerly 1B7), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
PEPD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B7]
TA501727BM

USD 420.00

4 Weeks

Anti-PEPD mouse monoclonal antibody, clone OTI1B7 (formerly 1B7), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
PEPD Mouse Monoclonal Antibody [Clone ID: OTI1B7]
TA501727S

USD 159.00

2 Days

Anti-PEPD mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PEPD ICC Control Block
TB401970

USD 1,070.00

4 Weeks

Transient overexpression of PEPD (NM_000285) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PEPD ICC Control Block
TB428345

USD 1,070.00

4 Weeks

Transient overexpression of PEPD (NM_001166057) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PEPD ICC Control Block
TB428366

USD 1,070.00

4 Weeks

Transient overexpression of PEPD (NM_001166056) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PEPD (NM_000285) Human Recombinant Protein
TP721022

USD 330.00

3 Weeks

Purified recombinant protein of Human peptidase D (PEPD), transcript variant 1

Tag tag free
Expression Host E. coli
PEPD (NM_000285) Human Recombinant Protein
TP721022L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human peptidase D (PEPD), transcript variant 1

Tag tag free
Expression Host E. coli