Products

cDNA Clones (15)
Proteins (11)
Antibodies (1)
Jump to Filters
View as table Download
Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Tagged ORF Clone
RG201605

USD 460.00

In Stock

PSMB6 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Tagged ORF Clone Lentiviral Particle
RC201605L3V

USD 820.00

5 Weeks

Lenti ORF particles, PSMB6 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Tagged ORF Clone Lentiviral Particle
RC201605L4V

USD 820.00

7 Weeks

Lenti ORF particles, PSMB6 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Proteasome 20S beta 6 (PSMB6) (NM_001270481) Human Tagged ORF Clone
RC236612

USD 420.00

2 Weeks

PSMB6 (myc-DDK-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Untagged Clone
SC101180

USD 420.00

In Stock

PSMB6 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Tagged ORF Clone
RC201605L2

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Untagged Clone
SC322188

USD 420.00

In Stock

PSMB6 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Over-expression Lysate
LY419101

USD 396.00

5 Days

Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Proteasome 20S beta 6 (PSMB6) Rabbit Polyclonal Antibody
TA342170

USD 375.00

5 Days

Rabbit polyclonal Anti-PSMB6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB6 antibody: synthetic peptide directed towards the N terminal of human PSMB6. Synthetic peptide located within the following region: TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA
PSMB6 (35-239, His-tag) Human Protein
AR50176PU-N

USD 1,105.00

2 Weeks

PSMB6 (35-239, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
PSMB6 (35-239, His-tag) Human Protein
AR50176PU-S

USD 415.00

2 Weeks

PSMB6 (35-239, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Over-expression Lysate
LC419101

USD 121.00

2 Weeks

PSMB6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Mass Spec Standard
PH301605

USD 2,055.00

3 Weeks

PSMB6 MS Standard C13 and N15-labeled recombinant protein (NP_002789)

Tag C-Myc/DDK
Expression Host HEK293
Proteasome 20S beta 6 (PSMB6) (NM_001270481) Human Tagged ORF Clone
RG236612

USD 460.00

2 Weeks

PSMB6 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Proteasome 20S beta 6 (PSMB6) (NM_001270481) Human Untagged Clone
SC334506

USD 477.00

2 Weeks

PSMB6 (untagged) - Human proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Proteasome 20S beta 6 (PSMB6) ICC Control Block
TB401605

USD 1,040.00

4 Weeks

Transient overexpression of PSMB6 (NM_002798) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Proteasome 20S beta 6 (PSMB6) ICC Control Block
TB436612

USD 1,070.00

4 Weeks

Transient overexpression of PSMB6 (NM_001270481) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Proteasome 20S beta 6 (PSMB6) Cytosection
TS401605

USD 225.00

4 Weeks

Transient overexpression of PSMB6 (NM_002798) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Proteasome 20S beta 6 (PSMB6) Cytosection
TS401605P5

USD 889.00

4 Weeks

Transient overexpression of PSMB6 (NM_002798) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Proteasome 20S beta 6 (PSMB6) ICC Control Sections
TS436612P5

USD 889.00

4 Weeks

Transient overexpression of PSMB6 (NM_001270481) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack