Products

cDNA Clones (20)
Antibodies (17)
Proteins (12)
Jump to Filters
View as table Download
PHKG2 (NM_000294) Human Tagged ORF Clone
RC200597

USD 98.00

USD 560.00

In Stock

PHKG2 (Myc-DDK-tagged)-Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PHKG2 (NM_001172432) Human Tagged ORF Clone
RC229959

USD 98.00

USD 460.00

In Stock

PHKG2 (Myc-DDK-tagged)-Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PHKG2 (NM_000294) Human Tagged ORF Clone Lentiviral Particle
RC200597L1V

USD 820.00

3 Weeks

Lenti ORF particles, PHKG2 (Myc-DDK tagged) - Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PHKG2 (NM_000294) Human Tagged ORF Clone Lentiviral Particle
RC200597L2V

USD 820.00

6 Weeks

Lenti ORF particles, PHKG2 (mGFP-tagged) - Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PHKG2 (NM_000294) Human Tagged ORF Clone
RG200597

USD 460.00

In Stock

PHKG2 (GFP-tagged) - Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PHKG2 (NM_000294) Human Tagged ORF Clone
RC200597L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PHKG2 (NM_000294) Human Tagged ORF Clone Lentiviral Particle
RC200597L3V

USD 820.00

5 Weeks

Lenti ORF particles, PHKG2 (Myc-DDK tagged) - Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PHKG2 (NM_000294) Human Tagged ORF Clone
RC200597L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PHKG2 (NM_000294) Human Tagged ORF Clone Lentiviral Particle
RC200597L4V

USD 820.00

7 Weeks

Lenti ORF particles, PHKG2 (mGFP-tagged) - Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PHKG2 (NM_001172432) Human Tagged ORF Clone
RC229959L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PHKG2 (NM_001172432) Human Tagged ORF Clone Lentiviral Particle
RC229959L3V

USD 820.00

6 Weeks

Lenti ORF particles, PHKG2 (Myc-DDK tagged) - Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PHKG2 (NM_001172432) Human Tagged ORF Clone
RC229959L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PHKG2 (NM_001172432) Human Tagged ORF Clone Lentiviral Particle
RC229959L4V

USD 820.00

6 Weeks

Lenti ORF particles, PHKG2 (mGFP-tagged) - Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PHKG2 (NM_001172432) Human Tagged ORF Clone
RG229959

USD 460.00

3 Weeks

PHKG2 (GFP-tagged) - Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PHKG2 (NM_000294) Human Tagged ORF Clone
RC200597L1

USD 768.00

In Stock

Lenti ORF clone of Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PHKG2 (NM_000294) Human Untagged Clone
SC321556

USD 310.00

In Stock

PHKG2 (untagged)-Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SC321556 is the updated version of SC119992.
PHKG2 (NM_000294) Human Tagged ORF Clone
RC200597L2

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PHKG2 (NM_000294) Human Untagged Clone
SC323409

USD 760.00

In Stock

PHKG2 (untagged)-Kinase deficient mutant (K53M) of Human phosphorylase kinase, gamma 2 (testis) (PHKG2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PHKG2 (NM_000294) Human Over-expression Lysate
LC400111

USD 121.00

In Stock

PHKG2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
PHKG2 (NM_000294) Human Over-expression Lysate
LY400111

USD 396.00

5 Days

Transient overexpression lysate of phosphorylase kinase, gamma 2 (testis) (PHKG2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PHKG2 (NM_000294) Human Untagged Clone
SC323429

USD 760.00

In Stock

PHKG2 (untagged)-Kinase deficient mutant (K53M) of Human phosphorylase kinase, gamma 2 (testis) (PHKG2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PHKG2 Rabbit Polyclonal Antibody
TA332363

USD 375.00

5 Days

Rabbit Polyclonal Anti-PHKG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PHKG2 Antibody: synthetic peptide directed towards the N terminal of human PHKG2. Synthetic peptide located within the following region: EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV
PHKG2 (NM_000294) Human Recombinant Protein
TP762022

USD 215.00

In Stock

Purified recombinant protein of Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1,Met1-Leu216, with N-terminal His tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
PHKG2 Mouse Monoclonal Antibody [Clone ID: OTI2E5]
CF800343

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PHKG2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
PHKG2 Mouse Monoclonal Antibody [Clone ID: OTI2A3]
CF800354

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PHKG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
PHKG2 Mouse Monoclonal Antibody [Clone ID: OTI1F9]
CF800355

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
PHKG2 (NM_001172432) Human Over-expression Lysate
LC432959

USD 121.00

2 Weeks

PHKG2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PHKG2 (NM_001172432) Human Over-expression Lysate
LY432959

USD 396.00

5 Days

Transient overexpression lysate of phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PHKG2 (NM_001172432) Human Untagged Clone
SC328597

USD 640.00

3 Weeks

PHKG2 (untagged)-Human phosphorylase kinase gamma 2 (testis) (PHKG2) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PHKG2 Rabbit Polyclonal Antibody
TA351527

USD 345.00

In Stock

Rabbit Polyclonal Anti-PHKG2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHKG2
PHKG2 Mouse Monoclonal Antibody [Clone ID: OTI2E5]
TA800343

USD 379.00

In Stock

PHKG2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
PHKG2 Mouse Monoclonal Antibody [Clone ID: OTI2E5]
TA800343S

USD 159.00

2 Days

PHKG2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
PHKG2 Mouse Monoclonal Antibody [Clone ID: OTI2A3]
TA800354

USD 379.00

In Stock

PHKG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
PHKG2 Mouse Monoclonal Antibody [Clone ID: OTI2A3]
TA800354S

USD 159.00

2 Days

PHKG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
PHKG2 Mouse Monoclonal Antibody [Clone ID: OTI1F9]
TA800355

USD 379.00

In Stock

PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
PHKG2 Mouse Monoclonal Antibody [Clone ID: OTI1F9]
TA800355S

USD 159.00

2 Days

PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
PHKG2 ICC Control Block
TB400597

USD 1,210.00

4 Weeks

Transient overexpression of PHKG2 (NM_000294) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PHKG2 ICC Control Block
TB429959

USD 1,110.00

4 Weeks

Transient overexpression of PHKG2 (NM_001172432) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PHKG2 (NM_000294) Human Recombinant Protein
TP762542

USD 261.00

2 Weeks

Purified recombinant protein of Human phosphorylase kinase, gamma 2 (testis) (PHKG2), transcript variant 1, 50ug

Tag N-GST and C-HIS
Expression Host E. coli
PHKG2 Cytosection
TS400597

USD 225.00

4 Weeks

Transient overexpression of PHKG2 (NM_000294) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PHKG2 Cytosection
TS400597P5

USD 889.00

4 Weeks

Transient overexpression of PHKG2 (NM_000294) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PHKG2 Cytosection
TS429959

USD 225.00

4 Weeks

Transient overexpression of PHKG2 (NM_001172432) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PHKG2 Cytosection
TS429959P5

USD 889.00

4 Weeks

Transient overexpression of PHKG2 (NM_001172432) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack