Germany
Japan
United Kingdom
China
FRK (Myc-DDK-tagged)-Human fyn-related kinase (FRK)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, FRK (Myc-DDK tagged) - Human fyn-related kinase (FRK), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, FRK (mGFP-tagged) - Human fyn-related kinase (FRK), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
FRK (GFP-tagged) - Human fyn-related kinase (FRK)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human fyn-related kinase (FRK), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FRK (Myc-DDK tagged) - Human fyn-related kinase (FRK), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human fyn-related kinase (FRK), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FRK (mGFP-tagged) - Human fyn-related kinase (FRK), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FRK Mutant (R239X), Myc-DDK-tagged ORF clone of Homo sapiens fyn-related kinase (FRK) as transfection-ready DNA
| Mutation | R239X |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human fyn-related kinase (FRK), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of fyn-related kinase (FRK)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
FRK (untagged)-Human fyn-related kinase (FRK)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human fyn-related kinase (FRK), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
FRK HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-FRK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FRK antibody: synthetic peptide directed towards the N terminal of human FRK. Synthetic peptide located within the following region: LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH |
Rabbit Polyclonal Anti-FRK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FRK antibody: synthetic peptide directed towards the middle region of human FRK. Synthetic peptide located within the following region: DLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPG |
Rabbit Polyclonal Anti-FRK Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FRK |
Transient overexpression of FRK (NM_002031) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FRK (NM_002031) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- FRK
Families
- Protein Kinase