Products

cDNA Clones (13)
Antibodies (6)
Proteins (5)
Jump to Filters
View as table Download
GRK3 (NM_005160) Human Tagged ORF Clone
RC215129

USD 760.00

In Stock

ADRBK2 (Myc-DDK-tagged)-Human adrenergic, beta, receptor kinase 2 (ADRBK2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GRK3 (NM_005160) Human Tagged ORF Clone Lentiviral Particle
RC215129L1V

USD 1,160.00

3 Weeks

Lenti ORF particles, ADRBK2 (Myc-DDK tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GRK3 (NM_005160) Human Tagged ORF Clone Lentiviral Particle
RC215129L2V

USD 1,160.00

6 Weeks

Lenti ORF particles, ADRBK2 (mGFP-tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GRK3 (NM_005160) Human Tagged ORF Clone
RG215129

USD 840.00

In Stock

ADRBK2 (GFP-tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK3 (NM_005160) Human Tagged ORF Clone
RC215129L3

USD 960.00

3 Weeks

Lenti ORF clone of Human adrenergic, beta, receptor kinase 2 (ADRBK2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK3 (NM_005160) Human Tagged ORF Clone Lentiviral Particle
RC215129L3V

USD 1,160.00

5 Weeks

Lenti ORF particles, ADRBK2 (Myc-DDK tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK3 (NM_005160) Human Tagged ORF Clone
RC215129L4

USD 960.00

3 Weeks

Lenti ORF clone of Human adrenergic, beta, receptor kinase 2 (ADRBK2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK3 (NM_005160) Human Tagged ORF Clone Lentiviral Particle
RC215129L4V

USD 1,160.00

7 Weeks

Lenti ORF particles, ADRBK2 (mGFP-tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK3 (NM_005160) Human Tagged ORF Clone
RC215129L1

USD 1,188.00

In Stock

Lenti ORF clone of Human adrenergic, beta, receptor kinase 2 (ADRBK2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GRK3 (NM_005160) Human Untagged Clone
SC116916

USD 1,400.00

In Stock

ADRBK2 (untagged)-Human adrenergic, beta, receptor kinase 2 (ADRBK2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GRK3 (NM_005160) Human Untagged Clone
SC323529

USD 1,400.00

In Stock

ADRBK2 (untagged)-Kinase deficient mutant (K220M) of Human adrenergic, beta, receptor kinase 2 (ADRBK2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GRK3 Rabbit Polyclonal Antibody
TA327241

USD 275.00

3 Weeks

ADRBK2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADRBK2
GRK3 (NM_005160) Human Tagged ORF Clone
RC215129L2

USD 960.00

3 Weeks

Lenti ORF clone of Human adrenergic, beta, receptor kinase 2 (ADRBK2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GRK3 (N-term) Rabbit Polyclonal Antibody
AP50100PU-N

USD 450.00

2 Weeks

GRK3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 36~65 amino acids from the N-terminal region of human ADRBK2
GRK3 (NM_005160) Human Over-expression Lysate
LC417480

USD 187.00

In Stock

ADRBK2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GRK3 Rabbit Polyclonal Antibody
AP20381PU-N

USD 370.00

2 Weeks

GRK3 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
GRK3 Rabbit Polyclonal Antibody
TA312914

USD 345.00

4 Weeks

Rabbit polyclonal anti-GRK3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human GRK3.
GRK3 Rabbit Polyclonal Antibody
TA340058

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADRBK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRBK2 antibody: synthetic peptide directed towards the N terminal of human ADRBK2. Synthetic peptide located within the following region: FCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC
GRK3 (NM_005160) Human Over-expression Lysate
LY417480

USD 605.00

5 Days

Transient overexpression lysate of adrenergic, beta, receptor kinase 2 (ADRBK2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GRK3 (NM_005160) Human Untagged Clone
SC116917

USD 1,400.00

4 Weeks

ADRBK2 (untagged)-ORIGENE UNIQUE VARIANT 1 of Human adrenergic, beta, receptor kinase 2 (ADRBK2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GRK3 Rabbit Polyclonal Antibody
TA349579

USD 345.00

In Stock

Rabbit Polyclonal Anti-ADRBK2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ADRBK2
GRK3 ICC Control Block
TB415129

USD 1,410.00

4 Weeks

Transient overexpression of GRK3 (NM_005160) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GRK3 Cytosection
TS415129

USD 225.00

4 Weeks

Transient overexpression of GRK3 (NM_005160) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GRK3 Cytosection
TS415129P5

USD 889.00

4 Weeks

Transient overexpression of GRK3 (NM_005160) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack