Germany
Japan
United Kingdom
China
FGF1 (GFP-tagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 7
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadFGF1 (GFP-tagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 9
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FGF1 (GFP-tagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 10
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FGF1 (GFP-tagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 11
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FGF1 (GFP-tagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 12
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Purified recombinant protein of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1.
| Tag | Tag Free |
| Expression Host | E. coli |
Recombinant protein of human Fibroblast Growth Factor-acidic (FGF1) produced in E. coli
| Tag | Tag Free |
| Expression Host | E. coli |
FGF acidic / FGF1 (Cell Culture Grade) porcine protein, 6 mg
| Protein Source | Brain |
FGF acidic / FGF1 (Cell Culture Grade) porcine protein, 5 x 6 mg
| Protein Source | Brain |
Lenti ORF clone of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
FGF1 (untagged)-Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Antibody against FGF1 (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 5-30 amino acids from the N-terminal region of human FGF1. |
FGF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-Fgf1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fgf1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTR |
FGF1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human FGF1 |
Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-Fgf1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Fgf1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ |
FGF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
FGF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
FGF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000791)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138364)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138406)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_001138407)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
FGF1 (untagged)-Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
FGF1 (untagged)-Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
FGF1 (untagged)-Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
FGF1 (untagged)-Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 6
| Vector | pCMV6 series |
| Tag | Tag Free |
FGF1 (untagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 7
| Vector | pCMV6 series |
| Tag | Tag Free |
FGF1 (untagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 8
| Vector | pCMV6 series |
| Tag | Tag Free |
FGF1 (untagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 9
| Vector | pCMV6 series |
| Tag | Tag Free |
FGF1 (untagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 10
| Vector | pCMV6 series |
| Tag | Tag Free |
FGF1 (untagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 11
| Vector | pCMV6 series |
| Tag | Tag Free |
FGF1 (untagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 12
| Vector | pCMV6 series |
| Tag | Tag Free |
FGF1 (untagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 13
| Vector | pCMV6 series |
| Tag | Tag Free |
FGF1 (untagged) - Homo sapiens fibroblast growth factor 1 (acidic) (FGF1), transcript variant 14
| Vector | pCMV6 series |
| Tag | Tag Free |
Anti-FGF1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1 |
Active filters
Target Symbol
- FGF1
Families
- Secreted Protein