Germany
Japan
United Kingdom
China
PLG (Myc-DDK-tagged)-Human plasminogen (PLG), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, PLG (Myc-DDK tagged) - Human plasminogen (PLG), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PLG (mGFP-tagged) - Human plasminogen (PLG), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PLG (GFP-tagged) - Human plasminogen (PLG), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human plasminogen (PLG), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, PLG (Myc-DDK tagged) - Human plasminogen (PLG), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human plasminogen (PLG), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, PLG (mGFP-tagged) - Human plasminogen (PLG), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PLG (Myc-DDK-tagged)-Human plasminogen (PLG), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of PLG (Myc-DDK-tagged)-Human plasminogen (PLG), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, PLG (Myc-DDK-tagged)-Human plasminogen (PLG), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PLG (mGFP-tagged)-Human plasminogen (PLG), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, PLG (mGFP-tagged)-Human plasminogen (PLG), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PLG (GFP-tagged) - Human plasminogen (PLG), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PLG (untagged)-Human plasminogen (PLG), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Plasmin human protein, 1 mg
| Protein Source | Plasma |
Plasminogen / PLG human protein, 1 mg
| Protein Source | Plasma |
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Plasminogen (PLG) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Transient overexpression lysate of plasminogen (PLG), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Plasminogen (PLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Goat polyclonal Plasminogen antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Plasminogen [Human Plasma] |
Plasminogen (PLG) goat polyclonal antibody, Serum
| Applications | ID, IP, R |
| Reactivities | Human |
| Immunogen | Native plasminogen is a single polypeptide chain, synthesized in the liver. Its molecular weight has been reported to be 81,000 and 92,000. Part of the molecule contains the active serine esterase of plasmin. On activation it is converted to two polypeptide chains linked by disulphide bridges. Three different abnormal molecular forms of plasminogen have been described. Normal adult plasma contains 10-20 mg/100 ml plasminogen. Different congenital molecular structure abnormalities associated with recurrent thrombosis have been described, but are extremely rare. In liver disease plasminogen activity may be reduced. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lenti ORF clone of Human plasminogen (PLG), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-PLG antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human PLG. |
Rabbit polyclonal PLG Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human PLG. |
Plasminogen (PLG) rabbit polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
PLG HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Purified recombinant protein of Human plasminogen (PLG), transcript variant 1,Ala301-Val586, with N-terminal His tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Rabbit polyclonal PLMN (heavy chain A short form, Cleaved-Val98) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PLMN. |
Goat polyclonal Plasminogen antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Plasminogen [Human Plasma] |
Rabbit Polyclonal Anti-PLG
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLG antibody: synthetic peptide directed towards the middle region of human PLG. Synthetic peptide located within the following region: LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE |
PLG (untagged)-Human plasminogen (PLG) transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of PLG (NM_000301) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLG (NM_001168338) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human plasminogen (PLG), transcript variant 1, full length, with N-GST and C-His tag, expressed in E.coli, 50ug
| Tag | N-GST and C-HIS |
| Expression Host | E. coli |
Purified recombinant protein of Human plasminogen (PLG), transcript variant 1, Glu20-End, with C-terminal His tag, expressed in E.coli, 50ug
| Tag | C-His |
| Expression Host | E. coli |
Transient overexpression of PLG (NM_000301) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLG (NM_000301) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PLG (NM_001168338) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PLG
Families
- Secreted Protein