Germany
Japan
United Kingdom
China
PLG (Myc-DDK-tagged)-Human plasminogen (PLG), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, PLG (Myc-DDK tagged) - Human plasminogen (PLG), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PLG (mGFP-tagged) - Human plasminogen (PLG), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Plg (Myc-DDK-tagged) - Mouse plasminogen (Plg)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PLG (GFP-tagged) - Human plasminogen (PLG), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Plg (GFP-tagged) - Mouse plasminogen (Plg), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Plg - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513469 is the updated version of KN313469.
Plg (GFP-tagged) - Mouse plasminogen (Plg)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Plg (Myc-DDK-tagged) - Mouse plasminogen (Plg)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Plg (Myc-DDK-tagged) - Mouse plasminogen (Plg), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Plg (mGFP-tagged) - Mouse plasminogen (Plg)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human plasminogen (PLG), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, PLG (Myc-DDK tagged) - Human plasminogen (PLG), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human plasminogen (PLG), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, PLG (mGFP-tagged) - Human plasminogen (PLG), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PLG (Myc-DDK-tagged)-Human plasminogen (PLG), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of PLG (Myc-DDK-tagged)-Human plasminogen (PLG), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, PLG (Myc-DDK-tagged)-Human plasminogen (PLG), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PLG (mGFP-tagged)-Human plasminogen (PLG), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, PLG (mGFP-tagged)-Human plasminogen (PLG), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PLG (GFP-tagged) - Human plasminogen (PLG), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Plg (Myc-DDK-tagged ORF) - Rat plasminogen (Plg), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Plg (Myc-DDK-tagged ORF) - Rat plasminogen (Plg), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Plg (Myc-DDK-tagged ORF) - Rat plasminogen (Plg), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Plg (mGFP-tagged ORF) - Rat plasminogen (Plg), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Plg (GFP-tagged ORF) - Rat plasminogen (Plg), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PLG (untagged)-Human plasminogen (PLG), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Plasmin human protein, 1 mg
| Protein Source | Plasma |
Plasminogen / PLG human protein, 1 mg
| Protein Source | Plasma |
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Plasminogen (PLG) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Transient overexpression lysate of plasminogen (PLG), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Plasminogen (PLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Plg (untagged) - Mouse plasminogen (Plg), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Goat polyclonal Plasminogen antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Plasminogen [Human Plasma] |
Plasminogen (PLG) goat polyclonal antibody, Serum
| Applications | ID, IP, R |
| Reactivities | Human |
| Immunogen | Native plasminogen is a single polypeptide chain, synthesized in the liver. Its molecular weight has been reported to be 81,000 and 92,000. Part of the molecule contains the active serine esterase of plasmin. On activation it is converted to two polypeptide chains linked by disulphide bridges. Three different abnormal molecular forms of plasminogen have been described. Normal adult plasma contains 10-20 mg/100 ml plasminogen. Different congenital molecular structure abnormalities associated with recurrent thrombosis have been described, but are extremely rare. In liver disease plasminogen activity may be reduced. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lenti ORF clone of Human plasminogen (PLG), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PLG (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit polyclonal anti-PLG antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human PLG. |
Rabbit polyclonal PLG Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human PLG. |
Plasminogen (PLG) rabbit polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
PLG HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Purified recombinant protein of Human plasminogen (PLG), transcript variant 1,Ala301-Val586, with N-terminal His tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Rabbit polyclonal PLMN (heavy chain A short form, Cleaved-Val98) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PLMN. |
Goat polyclonal Plasminogen antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Plasminogen [Human Plasma] |
Rabbit Polyclonal Anti-PLG
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLG antibody: synthetic peptide directed towards the middle region of human PLG. Synthetic peptide located within the following region: LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE |
Human Angiostatin K1-3 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human Angiostatin K1-3 |
| Reactivities | Human |
The Fast version of Picokine ELISA kits, assay takes less than 1.5 hours. Detect Human Plasminogen/PLG with <10pg/ml sensitivity. Format: 96-well plate with removable strips. Compatible samples: serum, plasma and cell culture supernates. This is a TMB colorimetric sandwich ELISA kit with short assay time and fast experiment set up. Plasminogen/PLG tissue specificity: Present in plasma and many other extracellular fluids. It is synthesized in the liver.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human Angiostatin K1-3 |
| Format | 8x12 divisible strips |
| Reactivities | Human |
PLG CRISPRa kit - CRISPR gene activation of human plasminogen
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Active filters
Target Symbol
- PLG