Products

View as table Download

PLG (Myc-DDK-tagged)-Human plasminogen (PLG), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Plg (Myc-DDK-tagged) - Mouse plasminogen (Plg)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PLG (GFP-tagged) - Human plasminogen (PLG), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Plg - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513469 is the updated version of KN313469.

Plg (GFP-tagged) - Mouse plasminogen (Plg)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Plg (Myc-DDK-tagged) - Mouse plasminogen (Plg)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Plg (mGFP-tagged) - Mouse plasminogen (Plg)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human plasminogen (PLG), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human plasminogen (PLG), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PLG (Myc-DDK-tagged)-Human plasminogen (PLG), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of PLG (mGFP-tagged)-Human plasminogen (PLG), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PLG (GFP-tagged) - Human plasminogen (PLG), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Plg (Myc-DDK-tagged ORF) - Rat plasminogen (Plg), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Plg (Myc-DDK-tagged ORF) - Rat plasminogen (Plg), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Plg (mGFP-tagged ORF) - Rat plasminogen (Plg), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Plg (GFP-tagged ORF) - Rat plasminogen (Plg), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PLG (untagged)-Human plasminogen (PLG), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

USD 275.00

5 Days

Plasmin human protein, 1 mg

Protein Source Plasma

Plasminogen / PLG human protein, 1 mg

Protein Source Plasma

Plasminogen (PLG) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Plasminogen isolated and purified from human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Plasminogen (PLG) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Plasminogen isolated and purified from Human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Plasminogen (PLG) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Plg (untagged) - Mouse plasminogen (Plg), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

Goat polyclonal Plasminogen antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Plasminogen [Human Plasma]

Plasminogen (PLG) goat polyclonal antibody, Serum

Applications ID, IP, R
Reactivities Human
Immunogen Native plasminogen is a single polypeptide chain, synthesized in the liver. Its molecular weight has been reported to be 81,000 and 92,000. Part of the molecule contains the active serine esterase of plasmin. On activation it is converted to two polypeptide chains linked by disulphide bridges. Three different abnormal molecular forms of plasminogen have been described. Normal adult plasma contains 10-20 mg/100 ml plasminogen. Different congenital molecular structure abnormalities associated with recurrent thrombosis have been described, but are extremely rare. In liver disease plasminogen activity may be reduced. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Lenti ORF clone of Human plasminogen (PLG), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

PLG (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Rabbit polyclonal anti-PLG antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human PLG.

Rabbit polyclonal PLG Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PLG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human PLG.

Plasminogen (PLG) rabbit polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen Plasminogen isolated and purified from Human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

PLG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Purified recombinant protein of Human plasminogen (PLG), transcript variant 1,Ala301-Val586, with N-terminal His tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli

Rabbit polyclonal PLMN (heavy chain A short form, Cleaved-Val98) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PLMN.

Goat polyclonal Plasminogen antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Plasminogen [Human Plasma]

Rabbit Polyclonal Anti-PLG

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLG antibody: synthetic peptide directed towards the middle region of human PLG. Synthetic peptide located within the following region: LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE

Carrier-free (BSA/glycerol-free) PLG mouse monoclonal antibody,clone OTI4F5

Applications IHC
Reactivities Human
Conjugation Unconjugated

Human Angiostatin K1-3 ELISA Kit

Assay Type Sandwich ELISA kit of Quantitative Detection for Human Angiostatin K1-3
Reactivities Human

The Fast version of Picokine ELISA kits, assay takes less than 1.5 hours. Detect Human Plasminogen/PLG with <10pg/ml sensitivity. Format: 96-well plate with removable strips. Compatible samples: serum, plasma and cell culture supernates. This is a TMB colorimetric sandwich ELISA kit with short assay time and fast experiment set up. Plasminogen/PLG tissue specificity: Present in plasma and many other extracellular fluids. It is synthesized in the liver.

Assay Type Sandwich ELISA kit of Quantitative Detection for Human Angiostatin K1-3
Format 8x12 divisible strips
Reactivities Human

PLG CRISPRa kit - CRISPR gene activation of human plasminogen

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector