Products

cDNA Clones (45)
Proteins (35)
Antibodies (7)
Jump to Filters
View as table Download
Thrombopoietin (THPO) (NM_000460) Human Tagged ORF Clone
RC221324

USD 420.00

In Stock

THPO (Myc-DDK-tagged)-Human thrombopoietin (THPO), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Thrombopoietin (THPO) (NM_001177597) Human Tagged ORF Clone
RC229926

USD 420.00

In Stock

THPO (Myc-DDK-tagged)-Human thrombopoietin (THPO), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Thrombopoietin (THPO) (NM_001290022) Human Tagged ORF Clone
RC237631

USD 420.00

In Stock

THPO (myc-DDK-tagged) - Human thrombopoietin (THPO), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_001289998) Human Tagged ORF Clone
RC237674

USD 420.00

In Stock

THPO (myc-DDK-tagged) - Human thrombopoietin (THPO), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_001290028) Human Tagged ORF Clone
RC237675

USD 420.00

In Stock

THPO (myc-DDK-tagged) - Human thrombopoietin (THPO), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_001177598) Human Tagged ORF Clone
RC229880

USD 420.00

3 Weeks

THPO (Myc-DDK-tagged)-Human thrombopoietin (THPO), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_001177598) Human Tagged ORF Clone Lentiviral Particle
RC229880L3V

USD 820.00

11 Weeks

Lenti ORF particles, THPO (Myc-DDK-tagged)-Human thrombopoietin (THPO), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thrombopoietin (THPO) (NM_001177597) Human Tagged ORF Clone Lentiviral Particle
RC229926L3V

USD 820.00

6 Weeks

Lenti ORF particles, THPO (Myc-DDK tagged) - Human thrombopoietin (THPO), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thrombopoietin (THPO) (NM_001289997) Human Tagged ORF Clone
RC237205

USD 420.00

2 Weeks

THPO (myc-DDK-tagged) - Human thrombopoietin (THPO), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_001290027) Human Tagged ORF Clone
RC237206

USD 420.00

2 Weeks

THPO (myc-DDK-tagged) - Human thrombopoietin (THPO), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_001290026) Human Tagged ORF Clone
RC237418

USD 420.00

2 Weeks

THPO (myc-DDK-tagged) - Human thrombopoietin (THPO), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_001290003) Human Tagged ORF Clone
RC238552

USD 420.00

2 Weeks

THPO (myc-DDK-tagged) - Human thrombopoietin (THPO), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_000460) Human Tagged ORF Clone
RG221324

USD 460.00

3 Weeks

THPO (GFP-tagged) - Human thrombopoietin (THPO), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_001177598) Human Tagged ORF Clone
RG229880

USD 460.00

3 Weeks

THPO (GFP-tagged) - Human thrombopoietin (THPO), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_001177597) Human Tagged ORF Clone
RG229926

USD 460.00

3 Weeks

THPO (GFP-tagged) - Human thrombopoietin (THPO), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_000460) Human Recombinant Protein
TP723455

USD 240.00

2 Weeks

Purified recombinant protein of Human thrombopoietin (THPO), transcript variant 1.

Tag Tag Free
Expression Host E. coli
Thrombopoietin Human Protein
DA3549

USD 240.00

2 Weeks

Thrombopoietin human recombinant protein, 10 µg

Expression Host E. coli
Thrombopoietin (THPO) (NM_000460) Human Untagged Clone
SC300074

USD 760.00

In Stock

THPO (untagged)-Human thrombopoietin (THPO), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Thrombopoietin Human Protein
DA3549S

USD 155.00

2 Weeks

Thrombopoietin human recombinant protein, 2 µg

Expression Host E. coli
Thrombopoietin Human Protein
DA3549X

USD 485.00

2 Weeks

Thrombopoietin human recombinant protein, 50 µg

Expression Host E. coli
Thrombopoietin (THPO) Rabbit Polyclonal Antibody
TA323653

USD 345.00

4 Weeks

Anti-THPO Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 22-349 amino acids of human Thrombopoietin
Thrombopoietin (THPO) Rabbit Polyclonal Antibody
TA344223

USD 475.00

5 Days

Rabbit Polyclonal Anti-THPO Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THPO antibody: synthetic peptide directed towards the middle region of human THPO. Synthetic peptide located within the following region: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS
Thrombopoietin (THPO) Rabbit Polyclonal Antibody
TA344224

USD 475.00

5 Days

Rabbit Polyclonal Anti-THPO Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THPO antibody: synthetic peptide directed towards the middle region of human THPO. Synthetic peptide located within the following region: HELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP
Thrombopoietin (THPO) (NM_000460) Human Tagged ORF Clone
RC221324L2

USD 620.00

3 Weeks

Lenti ORF clone of Human thrombopoietin (THPO), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Thrombopoietin (THPO) (NM_000460) Human Over-expression Lysate
LC424704

USD 121.00

In Stock

THPO HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Thrombopoietin (THPO) (NM_000460) Human Over-expression Lysate
LY424704

USD 396.00

In Stock

Transient overexpression lysate of thrombopoietin (THPO)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Thrombopoietin (THPO) Goat Polyclonal Antibody
TA328461

USD 285.00

5 Days

Anti-Human TPO Goat Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TPO
Thrombopoietin (THPO) Rabbit Polyclonal Antibody
TA317418

USD 425.00

5 Days

Thrombopoietin Rabbit Polyclonal (aa35-50) Antibody

Applications IHC
Reactivities Human
Immunogen THPO / TPO / Thrombopoietin antibody was raised against synthetic peptide from human THPO / Thrombopoietin.
Thrombopoietin (THPO) Rabbit Polyclonal Antibody
TA319079

USD 355.00

3 Weeks

Rabbit polyclonal anti-THPO (TPO) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human TPO
Thrombopoietin (THPO) Goat Polyclonal Antibody
TA328460

USD 285.00

5 Days

Biotinylated Anti-Human TPO Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TPO
Thrombopoietin (22-353, His-tag)
AR51877PU-N

USD 1,105.00

2 Weeks

Recombinant human THPO, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Tag His-tag
Expression Host Other
Thrombopoietin (22-353, His-tag)
AR51877PU-S

USD 415.00

2 Weeks

Recombinant human THPO, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Tag His-tag
Expression Host Other
Thrombopoietin (THPO) (NM_001177597) Human Over-expression Lysate
LC432926

USD 121.00

2 Weeks

THPO HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Thrombopoietin (THPO) (NM_001177597) Human Over-expression Lysate
LY432926

USD 396.00

5 Days

Transient overexpression lysate of thrombopoietin (THPO), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Thrombopoietin (THPO) (NM_001289997) Human Tagged ORF Clone
RG237205

USD 460.00

2 Weeks

THPO (GFP-tagged) - Human thrombopoietin (THPO), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_001290027) Human Tagged ORF Clone
RG237206

USD 460.00

2 Weeks

THPO (GFP-tagged) - Human thrombopoietin (THPO), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_001290026) Human Tagged ORF Clone
RG237418

USD 460.00

2 Weeks

THPO (GFP-tagged) - Human thrombopoietin (THPO), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thrombopoietin (THPO) (NM_001290022) Human Tagged ORF Clone
RG237631

USD 460.00

2 Weeks

THPO (GFP-tagged) - Human thrombopoietin (THPO), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®