Germany
Japan
United Kingdom
China
ANXA3 (Myc-DDK-tagged)-Human annexin A3 (ANXA3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human annexin A3 (ANXA3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ANXA3 (GFP-tagged) - Human annexin A3 (ANXA3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human annexin A3 (ANXA3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ANXA3 (Myc-DDK tagged) - Human annexin A3 (ANXA3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human annexin A3 (ANXA3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ANXA3 (mGFP-tagged) - Human annexin A3 (ANXA3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ANXA3 (untagged)-Human annexin A3 (ANXA3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ANXA3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ANXA3 (untagged)-Human annexin A3 (ANXA3)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ANXA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the N terminal of human ANXA3. Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN |
Annexin A3 / ANXA3 (1-323) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
Rabbit Polyclonal Anti-ANXA3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the C terminal of human ANXA3. Synthetic peptide located within the following region: RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD |
Annexin A3 / ANXA3 (1-323) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
Transient overexpression lysate of annexin A3 (ANXA3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ANXA3 MS Standard C13 and N15-labeled recombinant protein (NP_005130)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of ANXA3 (NM_005139) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human annexin A3 (ANXA3)
| Tag | tag free |
| Expression Host | E. coli |
Active filters
Target Symbol
- ANXA3
Families
- Stem cell - Pluripotency