ANXA3 (Myc-DDK-tagged)-Human annexin A3 (ANXA3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ANXA3 (Myc-DDK-tagged)-Human annexin A3 (ANXA3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human annexin A3 (ANXA3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ANXA3 (GFP-tagged) - Human annexin A3 (ANXA3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human annexin A3 (ANXA3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ANXA3 (Myc-DDK tagged) - Human annexin A3 (ANXA3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human annexin A3 (ANXA3), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ANXA3 (mGFP-tagged) - Human annexin A3 (ANXA3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-ANXA3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ANXA3 |
ANXA3 (untagged)-Human annexin A3 (ANXA3)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Annexin A3 (ANXA3) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
ANXA3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ANXA3 (untagged)-Human annexin A3 (ANXA3)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ANXA3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the N terminal of human ANXA3. Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN |
Annexin A3 / ANXA3 (1-323) human recombinant protein, 0.1 mg
Expression Host | E. coli |
Rabbit Polyclonal Anti-ANXA3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the C terminal of human ANXA3. Synthetic peptide located within the following region: RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD |
Annexin A3 / ANXA3 (1-323) human recombinant protein, 0.5 mg
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) ANXA3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANXA3 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANXA3 mouse monoclonal antibody, clone OTI8A12 (formerly 8A12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANXA3 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANXA3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANXA3 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression lysate of annexin A3 (ANXA3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ANXA3 MS Standard C13 and N15-labeled recombinant protein (NP_005130)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), Biotinylated
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1F11 (formerly 1F11), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1F11 (formerly 1F11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI8A12 (formerly 8A12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI8A12 (formerly 8A12), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI8A12 (formerly 8A12), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI8A12 (formerly 8A12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI2F3 (formerly 2F3), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI2F3 (formerly 2F3), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI5G4 (formerly 5G4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI5G4 (formerly 5G4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of ANXA3 (NM_005139) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human annexin A3 (ANXA3)
Tag | tag free |
Expression Host | E. coli |