PFN1 (Myc-DDK-tagged)-Human profilin 1 (PFN1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PFN1 (Myc-DDK-tagged)-Human profilin 1 (PFN1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human profilin 1 (PFN1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, PFN1 (Myc-DDK tagged) - Human profilin 1 (PFN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, PFN1 (mGFP-tagged) - Human profilin 1 (PFN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PFN1 (GFP-tagged) - Human profilin 1 (PFN1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human profilin 1 (PFN1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, PFN1 (Myc-DDK tagged) - Human profilin 1 (PFN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, PFN1 (mGFP-tagged) - Human profilin 1 (PFN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-PFN1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PFN1 antibody: synthetic peptide directed towards the N terminal of human PFN1. Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL |
Lenti ORF clone of Human profilin 1 (PFN1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of profilin 1 (PFN1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PFN1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PFN1 |
Lenti ORF clone of Human profilin 1 (PFN1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PFN1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Profilin 1 Antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the human protein (within residues 100-140). [Swiss-Prot# P07737] |
PFN1 MS Standard C13 and N15-labeled recombinant protein (NP_005013)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Profilin-1 / PFN1 (1-140) human recombinant protein, 0.5 mg
Expression Host | E. coli |
Profilin-1 / PFN1 (1-140) human recombinant protein, 0.1 mg
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) PFN1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PFN1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Anti-PFN1 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 2-140 amino acids of human profilin 1 |
Anti-PFN1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 2-140 amino acids of human profilin 1 |
Rabbit Polyclonal Anti-PFN1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PFN1 |
Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Transient overexpression of PFN1 (NM_005022) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PFN1 (NM_005022) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PFN1 (NM_005022) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack