Germany
Japan
United Kingdom
China
Products
View as table Download
Lenti ORF clone of Human v-myb myeloblastosis viral oncogene homolog (avian) (MYB), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of v-myb myeloblastosis viral oncogene homolog (avian) (MYB), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of v-myb myeloblastosis viral oncogene homolog (avian) (MYB), transcript variant 5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human v-myb myeloblastosis viral oncogene homolog (avian) (MYB), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MYB (untagged)-Human v-myb myeloblastosis viral oncogene homolog (avian) (MYB), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Myb Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Myb |
Rabbit polyclonal Myb (Phospho-Ser532) antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Myb around the phosphorylation site of serine 532 (V-E-SP-P-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal Myb (Ab-532) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Myb around the phosphorylation site of serine 532 (V-E-SP-P-T). |
Rabbit Polyclonal Phospho-Myb (Ser532) Antibody (Phospho-specific)
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Myb around the phosphorylation site of Serine 532 |
| Modifications | Phospho-specific |
c-Myb (MYB) (557-569) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
| Immunogen | Peptide corresponding to internal region of Human c-Myb |
MYB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
MYB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-MYB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYB antibody: synthetic peptide directed towards the N terminal of human MYB. Synthetic peptide located within the following region: YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD |
Rabbit Polyclonal Anti-MYB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MYB antibody is: synthetic peptide directed towards the C-terminal region of Human MYB. Synthetic peptide located within the following region: AFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSART |
Rabbit Polyclonal anti-MYB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MYB antibody is: synthetic peptide directed towards the C-terminal region of Human MYB. Synthetic peptide located within the following region: VPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM |
Mouse anti c-myb / v-myb Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
MYB (untagged)-Human v-myb myeloblastosis viral oncogene homolog (avian) (MYB), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MYB (untagged)-Human v-myb myeloblastosis viral oncogene homolog (avian) (MYB) transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MYB (untagged)-Human v-myb myeloblastosis viral oncogene homolog (avian) (MYB) transcript variant 7
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MYB (untagged)-Human v-myb myeloblastosis viral oncogene homolog (avian) (MYB) transcript variant 8
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MYB (untagged)-Human v-myb myeloblastosis viral oncogene homolog (avian) (MYB) transcript variant 6
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MYB (untagged)-Human v-myb myeloblastosis viral oncogene homolog (avian) (MYB) transcript variant 4
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MYB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MYB |
Transient overexpression of MYB (NM_005375) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYB (NM_001130172) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYB (NM_001130173) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYB (NM_001161657) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYB (NM_001161659) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYB (NM_001161660) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYB (NM_001161658) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYB (NM_001161656) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYB (NM_005375) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MYB (NM_005375) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MYB (NM_001130172) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MYB (NM_001130172) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MYB (NM_001130173) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MYB (NM_001130173) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MYB (NM_001161657) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MYB (NM_001161657) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MYB (NM_001161659) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MYB (NM_001161659) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MYB (NM_001161660) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MYB (NM_001161660) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MYB (NM_001161658) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MYB (NM_001161656) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MYB
Families
- Transcription Factors