Products

cDNA Clones (39)
Proteins (19)
Antibodies (9)
Jump to Filters
View as table Download
PPP3CB (NM_021132) Human Tagged ORF Clone
RC206982

USD 420.00

In Stock

PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP3CB (NM_001142354) Human Tagged ORF Clone
RC227763

USD 470.00

In Stock

PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP3CB (NM_001142353) Human Tagged ORF Clone
RC227718

USD 420.00

In Stock

PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP3CB (NM_021132) Human Tagged ORF Clone Lentiviral Particle
RC206982L1V

USD 820.00

3 Weeks

Lenti ORF particles, PPP3CB (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PPP3CB (NM_021132) Human Tagged ORF Clone Lentiviral Particle
RC206982L2V

USD 820.00

6 Weeks

Lenti ORF particles, PPP3CB (mGFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PPP3CB (NM_001142353) Human Tagged ORF Clone Lentiviral Particle
RC227718L1V

USD 820.00

3 Weeks

Lenti ORF particles, PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PPP3CB (NM_001142353) Human Tagged ORF Clone Lentiviral Particle
RC227718L2V

USD 820.00

6 Weeks

Lenti ORF particles, PPP3CB (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PPP3CB (NM_001142354) Human Tagged ORF Clone Lentiviral Particle
RC227763L1V

USD 870.00

3 Weeks

Lenti ORF particles, PPP3CB (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PPP3CB (NM_001142354) Human Tagged ORF Clone Lentiviral Particle
RC227763L2V

USD 870.00

6 Weeks

Lenti ORF particles, PPP3CB (mGFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PPP3CB (NM_001142353) Human Tagged ORF Clone
RG227718

USD 460.00

In Stock

PPP3CB (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP3CB (NM_021132) Human Tagged ORF Clone
RC206982L3

USD 620.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP3CB (NM_021132) Human Tagged ORF Clone Lentiviral Particle
RC206982L3V

USD 820.00

7 Weeks

Lenti ORF particles, PPP3CB (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP3CB (NM_021132) Human Tagged ORF Clone
RC206982L4

USD 620.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP3CB (NM_021132) Human Tagged ORF Clone Lentiviral Particle
RC206982L4V

USD 820.00

7 Weeks

Lenti ORF particles, PPP3CB (mGFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP3CB (NM_001142353) Human Tagged ORF Clone
RC227718L3

USD 620.00

3 Weeks

Lenti-ORF clone of PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP3CB (NM_001142353) Human Tagged ORF Clone Lentiviral Particle
RC227718L3V

USD 820.00

11 Weeks

Lenti ORF particles, PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP3CB (NM_001142353) Human Tagged ORF Clone
RC227718L4

USD 620.00

3 Weeks

Lenti-ORF clone of PPP3CB (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP3CB (NM_001142353) Human Tagged ORF Clone Lentiviral Particle
RC227718L4V

USD 820.00

11 Weeks

Lenti ORF particles, PPP3CB (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP3CB (NM_001142354) Human Tagged ORF Clone
RC227763L3

USD 670.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP3CB (NM_001142354) Human Tagged ORF Clone Lentiviral Particle
RC227763L3V

USD 870.00

7 Weeks

Lenti ORF particles, PPP3CB (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP3CB (NM_001142354) Human Tagged ORF Clone
RC227763L4

USD 670.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP3CB (NM_001142354) Human Tagged ORF Clone Lentiviral Particle
RC227763L4V

USD 870.00

7 Weeks

Lenti ORF particles, PPP3CB (mGFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP3CB (NM_001289969) Human Tagged ORF Clone
RC238045

USD 420.00

2 Weeks

PPP3CB (myc-DDK-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP3CB (NM_001289968) Human Tagged ORF Clone
RC238660

USD 480.00

3 Weeks

PPP3CB (myc-DDK-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP3CB (NM_021132) Human Tagged ORF Clone
RG206982

USD 460.00

3 Weeks

PPP3CB (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP3CB (NM_001142354) Human Tagged ORF Clone
RG227763

USD 520.00

3 Weeks

PPP3CB (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP3CB (NM_021132) Human Tagged ORF Clone
RC206982L1

USD 768.00

In Stock

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PPP3CB (NM_001142353) Human Tagged Lenti ORF Clone
RC227718L1

USD 768.00

In Stock

Lenti-ORF clone of PPP3CB (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PPP3CB (NM_021132) Human Untagged Clone
SC112977

USD 310.00

In Stock

PPP3CB (untagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC112977 is the updated version of SC128069.
PPP3CB (NM_001142354) Human Tagged ORF Clone
RC227763L1

USD 670.00

In Stock

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PPP3CB (NM_021132) Human Over-expression Lysate
LC412072

USD 121.00

In Stock

PPP3CB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP3CB Rabbit Polyclonal Antibody
TA344737

USD 475.00

5 Days

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI
PPP3CB Rabbit Polyclonal Antibody
TA344738

USD 475.00

5 Days

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
PPP3CB (NM_021132) Human Tagged ORF Clone
RC206982L2

USD 620.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PPP3CB (NM_001142353) Human Tagged ORF Clone
RC227718L2

USD 620.00

3 Weeks

Lenti-ORF clone of PPP3CB (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PPP3CB (NM_001142354) Human Tagged ORF Clone
RC227763L2

USD 670.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PPP3CB Rabbit Polyclonal Antibody
TA308439

USD 415.00

5 Days

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)
PPP3CB (NM_001142353) Human Over-expression Lysate
LC428053

USD 121.00

In Stock

PPP3CB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP3CB (NM_001142354) Human Over-expression Lysate
LC428054

USD 121.00

In Stock

PPP3CB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP3CB (NM_021132) Human Over-expression Lysate
LY412072

USD 396.00

In Stock

Transient overexpression lysate of protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform (PPP3CB), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP3CB (NM_001142353) Human Over-expression Lysate
LY428053

USD 396.00

In Stock

Transient overexpression lysate of protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform (PPP3CB), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP3CB Rabbit Polyclonal Antibody
TA318865

USD 380.00

3 Weeks

Rabbit polyclonal anti-Calcineurin A antibody

Applications WB
Reactivities Bovine, Hamster, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A
PPP3CB Mouse Monoclonal Antibody [Clone ID: OTI2E4]
CF809772

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPP3CB mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPP3CB (NM_001142354) Human Over-expression Lysate
LY428054

USD 396.00

5 Days

Transient overexpression lysate of protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform (PPP3CB), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP3CB (NM_001289969) Human Tagged ORF Clone
RG238045

USD 460.00

2 Weeks

PPP3CB (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP3CB (NM_001289968) Human Tagged ORF Clone
RG238660

USD 520.00

2 Weeks

PPP3CB (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP3CB (NM_001142353) Human Untagged Clone
SC325163

USD 760.00

3 Weeks

PPP3CB (untagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PPP3CB (NM_001142354) Human Untagged Clone
SC326014

USD 870.00

3 Weeks

PPP3CB (untagged)-Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PPP3CB (NM_001289969) Human Untagged Clone
SC335939

USD 410.00

2 Weeks

PPP3CB (untagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PPP3CB (NM_001289968) Human Untagged Clone
SC336554

USD 520.00

3 Weeks

PPP3CB (untagged) - Human protein phosphatase 3, catalytic subunit, beta isozyme (PPP3CB), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin