Products

Antibodies (22)
cDNA Clones (22)
Proteins (11)
Jump to Filters
View as table Download
PIAS2 (NM_173206) Human Tagged ORF Clone
RC203294

USD 480.00

In Stock

PIAS2 (Myc-DDK-tagged)-Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PIAS2 (NM_004671) Human Tagged ORF Clone
RC212659

USD 480.00

In Stock

PIAS2 (Myc-DDK-tagged)-Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PIAS2 (NM_173206) Human Tagged ORF Clone Lentiviral Particle
RC203294L1V

USD 880.00

3 Weeks

Lenti ORF particles, PIAS2 (Myc-DDK tagged) - Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PIAS2 (NM_173206) Human Tagged ORF Clone Lentiviral Particle
RC203294L2V

USD 880.00

6 Weeks

Lenti ORF particles, PIAS2 (mGFP-tagged) - Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PIAS2 (NM_004671) Human Tagged ORF Clone Lentiviral Particle
RC212659L1V

USD 880.00

4 Weeks

Lenti ORF particles, PIAS2 (Myc-DDK tagged) - Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PIAS2 (NM_004671) Human Tagged ORF Clone Lentiviral Particle
RC212659L2V

USD 880.00

6 Weeks

Lenti ORF particles, PIAS2 (mGFP-tagged) - Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PIAS2 (NM_173206) Human Tagged ORF Clone
RG203294

USD 530.00

In Stock

PIAS2 (GFP-tagged) - Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PIAS2 (NM_004671) Human Tagged ORF Clone
RG212659

USD 530.00

In Stock

PIAS2 (GFP-tagged) - Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PIAS2 (NM_173206) Human Tagged ORF Clone
RC203294L3

USD 680.00

3 Weeks

Lenti ORF clone of Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIAS2 (NM_173206) Human Tagged ORF Clone Lentiviral Particle
RC203294L3V

USD 880.00

5 Weeks

Lenti ORF particles, PIAS2 (Myc-DDK tagged) - Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIAS2 (NM_173206) Human Tagged ORF Clone
RC203294L4

USD 680.00

3 Weeks

Lenti ORF clone of Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIAS2 (NM_173206) Human Tagged ORF Clone Lentiviral Particle
RC203294L4V

USD 880.00

7 Weeks

Lenti ORF particles, PIAS2 (mGFP-tagged) - Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIAS2 (NM_004671) Human Tagged ORF Clone
RC212659L3

USD 680.00

3 Weeks

Lenti ORF clone of Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIAS2 (NM_004671) Human Tagged ORF Clone Lentiviral Particle
RC212659L3V

USD 880.00

6 Weeks

Lenti ORF particles, PIAS2 (Myc-DDK tagged) - Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIAS2 (NM_004671) Human Tagged ORF Clone
RC212659L4

USD 680.00

3 Weeks

Lenti ORF clone of Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIAS2 (NM_004671) Human Tagged ORF Clone Lentiviral Particle
RC212659L4V

USD 880.00

6 Weeks

Lenti ORF particles, PIAS2 (mGFP-tagged) - Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIAS2 (NM_173206) Human Tagged ORF Clone
RC203294L1

USD 840.00

In Stock

Lenti ORF clone of Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PIAS2 Rabbit Polyclonal Antibody
TA332818

USD 275.00

3 Weeks

Rabbit anti-PIAS2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PIAS2
PIAS2 (NM_004671) Human Over-expression Lysate
LY401487

USD 605.00

In Stock

Transient overexpression lysate of protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PIAS2 Rabbit Polyclonal Antibody
TA347490

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS2 Antibody: A synthesized peptide derived from human PIAS2
PIAS2 (NM_173206) Human Tagged ORF Clone
RC203294L2

USD 680.00

3 Weeks

Lenti ORF clone of Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PIAS2 (NM_004671) Human Tagged ORF Clone
RC212659L1

USD 680.00

In Stock

Lenti ORF clone of Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PIAS2 (NM_004671) Human Tagged ORF Clone
RC212659L2

USD 680.00

3 Weeks

Lenti ORF clone of Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PIAS2 Rabbit Polyclonal Antibody
TA312167

USD 345.00

In Stock

Rabbit polyclonal anti-PIAS2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS2.
PIAS2 Rabbit Polyclonal Antibody
TA319767

USD 430.00

5 Days

Rabbit Polyclonal PIAS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS2 antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human PIAS2.
PIAS2 (431-445) Goat Polyclonal Antibody
AP22538PU-N

USD 440.00

2 Weeks

PIAS2 (431-445) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bat, Canine, Equine, Human, Rabbit
Immunogen Synthetic peptide from an internal region of human PIAS2
PIAS2 (185-196) Goat Polyclonal Antibody
AP23730PU-N

USD 375.00

5 Days

PIAS2 (185-196) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Immunogen Peptide with sequence PQQVREICISRD, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2.
PIAS2 (NM_004671) Human Over-expression Lysate
LC401487

USD 187.00

In Stock

PIAS2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
PIAS2 (NM_173206) Human Over-expression Lysate
LC406651

USD 121.00

In Stock

PIAS2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PIAS2 (NM_004671) Human Untagged Clone
SC125358

USD 1,050.00

In Stock

PIAS2 (untagged)-Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PIAS2 (NM_173206) Human Untagged Clone
SC321603

USD 760.00

In Stock

PIAS2 (untagged)-Human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PIAS2 Goat Polyclonal Antibody
TA305708

USD 375.00

5 Days

Goat Anti-PIAS2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KEAMKVSSQPCTKIE, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2.
PIAS2 Rabbit Polyclonal Antibody
TA341797

USD 375.00

5 Days

Rabbit Polyclonal Anti-Pias2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pias2 antibody: synthetic peptide directed towards the C terminal of mouse Pias2. Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE
PIAS2 (NM_004671) Human Recombinant Protein
TP760271

USD 215.00

In Stock

Recombinant protein of human protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
PIAS2 Rabbit Polyclonal Antibody
TA335365

USD 375.00

5 Days

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIAS2 Antibody: synthetic peptide directed towards the N terminal of human PIAS2. Synthetic peptide located within the following region: RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPST
PIAS2 Rabbit Polyclonal Antibody
TA339095

USD 310.00

5 Days

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS2 antibody: synthetic peptide directed towards the C terminal of human PIAS2. Synthetic peptide located within the following region: LTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDIISLD
PIAS2 Rabbit Polyclonal Antibody
TA339096

USD 310.00

5 Days

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS2 antibody: synthetic peptide directed towards the C terminal of human PIAS2. Synthetic peptide located within the following region: FLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDI
PIAS2 Mouse Monoclonal Antibody [Clone ID: OTI2B5]
CF808326

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PIAS2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PIAS2 Mouse Monoclonal Antibody [Clone ID: OTI5B4]
CF808334

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PIAS2 mouse monoclonal antibody, clone OTI5B4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PIAS2 (NM_173206) Human Over-expression Lysate
LY406651

USD 396.00

5 Days

Transient overexpression lysate of protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PIAS2 Rabbit Polyclonal Antibody
TA350895

USD 345.00

In Stock

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIAS2
PIAS2 Mouse Monoclonal Antibody [Clone ID: OTI2B5]
TA808326

USD 379.00

In Stock

PIAS2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PIAS2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B5]
TA808326AM

USD 420.00

4 Weeks

PIAS2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
PIAS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B5]
TA808326BM

USD 420.00

4 Weeks

PIAS2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
PIAS2 Mouse Monoclonal Antibody [Clone ID: OTI2B5]
TA808326S

USD 159.00

2 Days

PIAS2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PIAS2 Mouse Monoclonal Antibody [Clone ID: OTI5B4]
TA808334

USD 379.00

In Stock

PIAS2 mouse monoclonal antibody,clone OTI5B4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PIAS2 Mouse Monoclonal Antibody [Clone ID: OTI5B4]
TA808334S

USD 159.00

2 Days

PIAS2 mouse monoclonal antibody,clone OTI5B4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PIAS2 (NM_173206) ICC Control Block
TB403294

USD 1,130.00

4 Weeks

Transient overexpression of PIAS2 (NM_173206) in HEK293T cells paraffin embedded controls for ICC/IHC staining