Germany
Japan
United Kingdom
China
FUBP1 (Myc-DDK-tagged)-Human far upstream element (FUSE) binding protein 1 (FUBP1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, FUBP1 (Myc-DDK tagged) - Human far upstream element (FUSE) binding protein 1 (FUBP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, FUBP1 (mGFP-tagged) - Human far upstream element (FUSE) binding protein 1 (FUBP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
FUBP1 (GFP-tagged) - Human far upstream element (FUSE) binding protein 1 (FUBP1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human far upstream element (FUSE) binding protein 1 (FUBP1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FUBP1 (Myc-DDK tagged) - Human far upstream element (FUSE) binding protein 1 (FUBP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human far upstream element (FUSE) binding protein 1 (FUBP1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FUBP1 (mGFP-tagged) - Human far upstream element (FUSE) binding protein 1 (FUBP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FUBP1 (myc-DDK-tagged) - Human far upstream element (FUSE) binding protein 1 (FUBP1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human far upstream element (FUSE) binding protein 1 (FUBP1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
FUBP1 (untagged)-Human far upstream element (FUSE) binding protein 1 (cDNA clone MGC:29580 IMAGE:4891583), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-FUBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the middle region of human FUBP1. Synthetic peptide located within the following region: YYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEY |
FUBP1 (untagged)-Human far upstream element (FUSE) binding protein 1 (FUBP1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human far upstream element (FUSE) binding protein 1 (FUBP1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
FUBP1 (untagged) - Human far upstream element (FUSE) binding protein 1 (FUBP1), transcript variant 1
| Vector | PCMV6-Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
FUBP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of far upstream element (FUSE) binding protein 1 (FUBP1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal FUBP1 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This FUBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 240-268 amino acids from the Central region of human FUBP1. |
Rabbit polyclonal Anti-FUBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the N terminal of human FUBP1. Synthetic peptide located within the following region: IGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEM |
Rabbit Polyclonal Anti-FUBP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the N terminal of human FUBP1. Synthetic peptide located within the following region: QIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQL |
FUBP1 (279-448, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
FUBP1 (279-448, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
FUBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003893)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
FUBP1 (GFP-tagged) - Human far upstream element (FUSE) binding protein 1 (FUBP1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Transient overexpression of FUBP1 (NM_003902) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FUBP1 (NM_001303433) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FUBP1 (NM_003902) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FUBP1 (NM_003902) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of FUBP1 (NM_001303433) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- FUBP1
Families
- Transcription Factors