Products

cDNA Clones (11)
Proteins (7)
Antibodies (3)
Jump to Filters
View as table Download
HOXB6 (NM_018952) Human Tagged ORF Clone
RC204197

USD 98.00

USD 390.00

In Stock

HOXB6 (Myc-DDK-tagged)-Human homeobox B6 (HOXB6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HOXB6 (NM_018952) Human Recombinant Protein
TP304197

USD 823.00

In Stock

Recombinant protein of human homeobox B6 (HOXB6)

Tag C-Myc/DDK
Expression Host HEK293T
HOXB6 (NM_018952) Human Tagged ORF Clone
RG204197

USD 460.00

In Stock

HOXB6 (GFP-tagged) - Human homeobox B6 (HOXB6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HOXB6 (NM_018952) Human Tagged ORF Clone
RC204197L3

USD 620.00

3 Weeks

Lenti ORF clone of Human homeobox B6 (HOXB6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HOXB6 (NM_018952) Human Tagged ORF Clone
RC204197L4

USD 620.00

3 Weeks

Lenti ORF clone of Human homeobox B6 (HOXB6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HOXB6 (NM_018952) Human Tagged ORF Clone
RC204197L1

USD 768.00

In Stock

Lenti ORF clone of Human homeobox B6 (HOXB6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
HOXB6 (Center) Rabbit Polyclonal Antibody
AP52079PU-N

USD 450.00

2 Weeks

HOXB6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 128-155 amino acids from the Central region of Human HOXB6 / HOX2B
HOXB6 (NM_018952) Human Untagged Clone
SC110922

USD 310.00

In Stock

HOXB6 (untagged)-Human homeobox B6 (HOXB6)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
HOXB6 Goat Polyclonal Antibody
TA326753

USD 375.00

5 Days

Goat Anti-HOXB6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EPRKSDCAQDKS, from the internal region of the protein sequence according to NP_061825.2.
HOXB6 Rabbit Polyclonal Antibody
TA329257

USD 375.00

5 Days

Rabbit Polyclonal anti-HOXB6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXB6 antibody: synthetic peptide directed towards the N terminal of human HOXB6. Synthetic peptide located within the following region: ALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCN
HOXB6 (NM_018952) Human Over-expression Lysate
LC412857

USD 121.00

2 Weeks

HOXB6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HOXB6 (NM_018952) Human Mass Spec Standard
PH304197

USD 2,055.00

3 Weeks

HOXB6 MS Standard C13 and N15-labeled recombinant protein (NP_061825)

Tag C-Myc/DDK
Expression Host HEK293
HOXB6 ICC Control Block
TB404197

USD 1,040.00

4 Weeks

Transient overexpression of HOXB6 (NM_018952) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HOXB6 Cytosection
TS404197

USD 225.00

4 Weeks

Transient overexpression of HOXB6 (NM_018952) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HOXB6 Cytosection
TS404197P5

USD 889.00

4 Weeks

Transient overexpression of HOXB6 (NM_018952) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack