HOXB6 (Myc-DDK-tagged)-Human homeobox B6 (HOXB6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HOXB6 (Myc-DDK-tagged)-Human homeobox B6 (HOXB6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human homeobox B6 (HOXB6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, HOXB6 (Myc-DDK tagged) - Human homeobox B6 (HOXB6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, HOXB6 (mGFP-tagged) - Human homeobox B6 (HOXB6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Hoxb6 (Myc-DDK-tagged) - Mouse homeobox B6 (Hoxb6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HOXB6 (GFP-tagged) - Human homeobox B6 (HOXB6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HOXB6 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Hoxb6 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Hoxb6 (GFP-tagged) - Mouse homeo box B6 (Hoxb6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Hoxb6 (Myc-DDK-tagged) - Mouse homeobox B6 (Hoxb6)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Hoxb6 (Myc-DDK-tagged) - Mouse homeobox B6 (Hoxb6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Hoxb6 (mGFP-tagged) - Mouse homeobox B6 (Hoxb6)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Hoxb6 (GFP-tagged) - Mouse homeobox B6 (Hoxb6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human homeobox B6 (HOXB6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HOXB6 (Myc-DDK tagged) - Human homeobox B6 (HOXB6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human homeobox B6 (HOXB6), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HOXB6 (mGFP-tagged) - Human homeobox B6 (HOXB6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
HOXB6 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXB6 |
Lenti ORF clone of Human homeobox B6 (HOXB6), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human homeobox B6 (HOXB6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
qSTAR qPCR primer pairs against Homo sapiens gene HOXB6
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
HOXB6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 128-155 amino acids from the Central region of Human HOXB6 / HOX2B |
Transient overexpression lysate of homeobox B6 (HOXB6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Hoxb6 (untagged) - Mouse homeobox B6 (Hoxb6), (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Hoxb6
HOXB6 (untagged)-Human homeobox B6 (HOXB6)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Goat Anti-HOXB6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EPRKSDCAQDKS, from the internal region of the protein sequence according to NP_061825.2. |
Rabbit Polyclonal anti-HOXB6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXB6 antibody: synthetic peptide directed towards the N terminal of human HOXB6. Synthetic peptide located within the following region: ALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCN |
HOXB6 CRISPRa kit - CRISPR gene activation of human homeobox B6
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Hoxb6 CRISPRa kit - CRISPR gene activation of mouse homeobox B6
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene HOXB6
Application | Plasmid of exact quantity for transcript copy number calculation |
HOXB6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Hoxb6
Application | Plasmid of exact quantity for transcript copy number calculation |
HOXB6 MS Standard C13 and N15-labeled recombinant protein (NP_061825)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
3`UTR clone of homeobox B6 (HOXB6) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
HOXB6 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Hoxb6 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
HOXB6 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXB6 |
HOXB6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human HOXB6 (NP_061825.2). |
Modifications | Unmodified |
Transient overexpression of HOXB6 (NM_018952) in HEK293T cells paraffin embedded controls for ICC/IHC staining
HOXB6 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
E. coli Selection | Chloramphenicol |
Mammalian Cell Selection | Puromycin |
HOXB6 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Hoxb6 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Hoxb6 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse homeobox B6 (Hoxb6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Tag | C-MYC/DDK |
Expression Host | HEK293T |
HOXB6 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
E. coli Selection | Ampicillin |
Mammalian Cell Selection | Puromycin |
Hoxb6 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Transient overexpression of HOXB6 (NM_018952) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HOXB6 (NM_018952) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack