ZEB2 (Myc-DDK-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
ZEB2 (Myc-DDK-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,000.00
3 Weeks
Lenti ORF particles, ZEB2 (Myc-DDK-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,000.00
3 Weeks
Lenti ORF particles, ZEB2 (mGFP-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ZEB2 (GFP-tagged) - Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ZEB2 (Myc-DDK-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
5 Weeks
Lenti ORF particles, ZEB2 (Myc-DDK-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
11 Weeks
Lenti ORF particles, ZEB2 (mGFP-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,250.00
5 Weeks
ZEB2 (Myc-DDK-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,450.00
5 Weeks
Lenti-ORF clone of ZEB2 (Myc-DDK-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,650.00
8 Weeks
Lenti ORF particles, ZEB2 (Myc-DDK-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,450.00
5 Weeks
Lenti-ORF clone of ZEB2 (mGFP-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,650.00
8 Weeks
Lenti ORF particles, ZEB2 (mGFP-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,380.00
7 Weeks
ZEB2 (GFP-tagged) - Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Smad Interacting Protein 1 (ZEB2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide, corresponding to amino acids 71-120 of Human SIP1. |
Rabbit Polyclonal Anti-ZEB2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ZEB2 |
Rabbit Polyclonal Anti-ZEB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the middle region of human ZEB2. Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME |
Rabbit polyclonal anti-ZEB2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZEB2. |
Rabbit Polyclonal ZEB2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ZEB2 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human ZEB2. |
Lenti-ORF clone of ZEB2 (mGFP-tagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ZEB2 (untagged)-Human zinc finger E-box binding homeobox 2 (ZEB2), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 525.00
2 Weeks
Smad Interacting Protein 1 (ZEB2) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | ZEB2 antibody was raised against an 18 amino acid synthetic near the carboxy terminus of Human ZEB2. |
Rabbit Polyclonal Anti-ZEB2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZEB2 Antibody: A synthesized peptide derived from human ZEB2 |
USD 440.00
2 Weeks
Smad Interacting Protein 1 (ZEB2) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
USD 450.00
2 Weeks
Smad Interacting Protein 1 (ZEB2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | Immunized with a KLH conjugated synthetic peptide between 1078-1105 amino acids from the C-terminal region of human ZEB2 |
Rabbit Polyclonal Anti-ZFHX1B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZFHX1B antibody: synthetic peptide directed towards the N terminal of human ZFHX1B. Synthetic peptide located within the following region: NVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALL |
Rabbit Polyclonal Anti-ZEB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the N terminal of human ZEB2. Synthetic peptide located within the following region: SETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEE |
Goat Anti-ZEB2 (aa545-558) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TDSRRQISNIKKEK, from the internal region of the protein sequence according to NP_055610.1; NP_001165124.1. |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI15G8 (formerly 15G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody,clone OTI4D12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody,clone OTI1E12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ZEB2 (untagged)-Human zinc finger E-box binding homeobox 2 (ZEB2) transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 379.00
In Stock
ZEB2 mouse monoclonal antibody, clone OTI15G8 (formerly 15G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 15G8, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 15G8, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
ZEB2 mouse monoclonal antibody, clone OTI15G8 (formerly 15G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ZEB2 mouse monoclonal antibody,clone OTI4D12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 4D12, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 4D12, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
ZEB2 mouse monoclonal antibody,clone OTI4D12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ZEB2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 3D8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 3D8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
ZEB2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ZEB2 mouse monoclonal antibody,clone OTI1E12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 1E12, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 1E12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
In Stock
ZEB2 mouse monoclonal antibody,clone OTI1E12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ZEB2 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |