P2RX4 (untagged)-Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
P2RX4 (untagged)-Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
P2RX4 (Myc-DDK-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, P2RX4 (Myc-DDK tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, P2RX4 (mGFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
P2RX4 (GFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, P2RX4 (Myc-DDK tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, P2RX4 (mGFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
P2RX4 (Myc-DDK tagged) - Homo sapiens purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
P2RX4 (Myc-DDK tagged) - Homo sapiens purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
P2RX4 (myc-DDK-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
P2RX4 (GFP-tagged) - Homo sapiens purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
P2RX4 (GFP-tagged) - Homo sapiens purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
P2RX4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
P2RX4 (untagged)-Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Goat Polyclonal Antibody against P2RX4
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YREKKYKYVEDYEQ, from the C Terminus of the protein sequence according to NP_002551.2. |
Rabbit Polyclonal Anti-P2RX4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-P2RX4 antibody: synthetic peptide directed towards the N terminal of human P2RX4. Synthetic peptide located within the following region: VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW |
P2RX4 MS Standard C13 and N15-labeled recombinant protein (NP_002551)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
P2RX4 (GFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
P2RX4 (untagged) - Homo sapiens purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
P2RX4 (untagged) - Homo sapiens purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
P2RX4 (untagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 6
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of P2RX4 (NM_002560) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RX4 (NM_001261397) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RX4 (NM_001256796) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RX4 (NM_001261398) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RX4 (NM_002560) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of P2RX4 (NM_002560) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of P2RX4 (NM_001261397) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of P2RX4 (NM_001256796) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of P2RX4 (NM_001261398) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack