Products

View as table Download

FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

FZD6 (GFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FZD6 (Myc-DDK tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of FZD6 (mGFP-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FZD6 (mGFP-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FZD6 (Myc-DDK tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FZD6 (mGFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

FZD6 (GFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

FZD6 (GFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

FZD6 (untagged)-Human frizzled family receptor 6 (FZD6), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of frizzled homolog 6 (Drosophila) (FZD6), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-FZD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD6 antibody: synthetic peptide directed towards the middle region of human FZD6. Synthetic peptide located within the following region: HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal anti-FZD6 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD6.

FZD6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Frizzled 6 (FZD6) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 493-520 amino acids from the Central region of human FZD6

FZD6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Transient overexpression lysate of frizzled family receptor 6 (FZD6), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

FZD6 (untagged)-Human frizzled homolog 6 (Drosophila) (FZD6) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

FZD6 (untagged)-Human frizzled homolog 6 (Drosophila) (FZD6) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Anti-FZD6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 47-60 amino acids of human frizzled family receptor 6

Transient overexpression of FZD6 (NM_003506) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of FZD6 (NM_001164616) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of FZD6 (NM_001164615) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of FZD6 (NM_003506) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of FZD6 (NM_003506) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of FZD6 (NM_001164616) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of FZD6 (NM_001164615) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of FZD6 (NM_001164615) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack