ABCC1 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ABCC1 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,670.00
3 Weeks
Lenti ORF particles, ABCC1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,670.00
6 Weeks
Lenti ORF particles, ABCC1 (mGFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ABCC1 (GFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,670.00
5 Weeks
Lenti ORF particles, ABCC1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,670.00
3 Weeks
Lenti ORF particles, ABCC1 (mGFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ABCC1 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Mouse Monoclonal MRP1 Antibody (IU5C1)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
ABCC1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
ABCC1 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 7
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Goat Anti-ABCC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HQSDLKVDENQKAYY, from the internal region of the protein sequence according to NP_004987.2; NP_063915.2; NP_063953.2;NP_063954.2; NP_063955.2. |
Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ABCC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC1 Antibody: synthetic peptide directed towards the middle region of human ABCC1. Synthetic peptide located within the following region: LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA |
Anti-ABCC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 |
Anti-ABCC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 |
Rabbit Polyclonal Anti-ABCC1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABCC1 |
Transient overexpression of ABCC1 (NM_004996) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCC1 (NM_004996) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ABCC1 (NM_004996) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack