Products

View as table Download

ABCC1 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, ABCC1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ABCC1 (mGFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

ABCC1 (GFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ABCC1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ABCC1 (mGFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ABCC1 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Mouse Monoclonal MRP1 Antibody (IU5C1)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

ABCC1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

ABCC1 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 7

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Goat Anti-ABCC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HQSDLKVDENQKAYY, from the internal region of the protein sequence according to NP_004987.2; NP_063915.2; NP_063953.2;NP_063954.2; NP_063955.2.

Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-ABCC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC1 Antibody: synthetic peptide directed towards the middle region of human ABCC1. Synthetic peptide located within the following region: LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA

Anti-ABCC1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1

Anti-ABCC1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1

Rabbit Polyclonal Anti-ABCC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCC1

Transient overexpression of ABCC1 (NM_004996) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ABCC1 (NM_004996) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of ABCC1 (NM_004996) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack