Germany
Japan
United Kingdom
China
ABCC1 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 1,670.00
3 Weeks
Lenti ORF particles, ABCC1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,670.00
6 Weeks
Lenti ORF particles, ABCC1 (mGFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ABCC1 (GFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Abcc1 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (Abcc1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Abcc1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500621 is the updated version of KN300621.
Abcc1 (GFP-tagged) - Mouse ATP-binding cassette sub-family C (CFTR/MRP) member 1 (Abcc1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abcc1 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (Abcc1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcc1 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (Abcc1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abcc1 (mGFP-tagged) - Mouse ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (Abcc1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcc1 (GFP-tagged) - Mouse ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (Abcc1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,670.00
5 Weeks
Lenti ORF particles, ABCC1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,670.00
3 Weeks
Lenti ORF particles, ABCC1 (mGFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Abcc1 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (Abcc1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCC1 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ABCC1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ABCC1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Abcc1
ABCC1 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
ABCC1 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 7
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Goat Anti-ABCC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQSDLKVDENQKAYY, from the internal region of the protein sequence according to NP_004987.2; NP_063915.2; NP_063953.2;NP_063954.2; NP_063955.2. |
Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ABCC1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
qSTAR qPCR primer pairs against Homo sapiens gene ABCC1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit Polyclonal Anti-ABCC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCC1 Antibody: synthetic peptide directed towards the middle region of human ABCC1. Synthetic peptide located within the following region: LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA |
ABCC1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
ABCC1 CRISPRa kit - CRISPR gene activation of human ATP binding cassette subfamily C member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Abcc1 CRISPRa kit - CRISPR gene activation of mouse ATP-binding cassette, sub-family C (CFTR/MRP), member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Abcc1 (untagged) - Mouse ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (Abcc1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Abcc1 (untagged ORF) - Rat ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (Abcc1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of ATP-binding cassette sub-family C (CFTR/MRP) member 1 (ABCC1) transcript variant 5 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of ATP-binding cassette sub-family C (CFTR/MRP) member 1 (ABCC1) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of ATP-binding cassette sub-family C (CFTR/MRP) member 1 (ABCC1) transcript variant 4 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of ATP-binding cassette sub-family C (CFTR/MRP) member 1 (ABCC1) transcript variant 3 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of ATP-binding cassette sub-family C (CFTR/MRP) member 1 (ABCC1) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Abcc1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Abcc1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-ABCC1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 |
MRP1/ABCC1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 850-960 of human MRP1/ABCC1 (NP_004987.2). |
| Modifications | Unmodified |
Transient overexpression of ABCC1 (NM_004996) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ABCC1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Abcc1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Abcc1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- ABCC1