Germany
Japan
United Kingdom
China
ACSL1 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 1 (ACSL1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ACSL1 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 1 (ACSL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ACSL1 (mGFP-tagged)-Human acyl-CoA synthetase long-chain family member 1 (ACSL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ACSL1 (myc-DDK-tagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACSL1 (GFP-tagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ACSL1 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 1 (ACSL1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACSL1 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 1 (ACSL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, ACSL1 (mGFP-tagged)-Human acyl-CoA synthetase long-chain family member 1 (ACSL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACSL1 (myc-DDK-tagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACSL1 (myc-DDK-tagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACSL1 (myc-DDK-tagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACSL1 (untagged)-Human acyl-CoA synthetase long-chain family member 1 (ACSL1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of ACSL1 (mGFP-tagged)-Human acyl-CoA synthetase long-chain family member 1 (ACSL1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of ACSL1 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 1 (ACSL1)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of ACSL1 (mGFP-tagged)-Human acyl-CoA synthetase long-chain family member 1 (ACSL1)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-ACSL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the N terminal of human ACSL1. Synthetic peptide located within the following region: ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY |
ACSL1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of acyl-CoA synthetase long-chain family member 1 (ACSL1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal ACSL1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal ACSL1 antibody was raised against an 18 amino acid peptide near the center of human ACSL1. The immunogen is located within amino acids 240 - 290 of ACSL1. |
Rabbit Polyclonal Anti-ACSL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the C terminal of human ACSL1. Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG |
ACSL1 (GFP-tagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACSL1 (GFP-tagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACSL1 (GFP-tagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACSL1 (GFP-tagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACSL1 (untagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ACSL1 (untagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ACSL1 (untagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ACSL1 (untagged) - Human acyl-CoA synthetase long-chain family member 1 (ACSL1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of ACSL1 (NM_001995) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACSL1 (NM_001286712) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACSL1 (NM_001286711) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACSL1 (NM_001286708) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACSL1 (NM_001286710) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACSL1 (NM_001995) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACSL1 (NM_001995) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACSL1 (NM_001286712) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACSL1 (NM_001286711) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACSL1 (NM_001286708) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACSL1 (NM_001286708) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACSL1 (NM_001286710) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ACSL1
Families
- Transmembrane