Products

cDNA Clones (29)
Proteins (16)
Antibodies (8)
Jump to Filters
View as table Download
TEM8 (ANTXR1) (NM_018153) Human Tagged ORF Clone
RC204112

USD 420.00

In Stock

ANTXR1 (Myc-DDK-tagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TEM8 (ANTXR1) (NM_053034) Human Tagged ORF Clone
RC218473

USD 420.00

In Stock

ANTXR1 (Myc-DDK-tagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TEM8 (ANTXR1) (NM_032208) Human Tagged ORF Clone
RG222030

USD 530.00

In Stock

ANTXR1 (GFP-tagged) - Human anthrax toxin receptor 1 (ANTXR1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TEM8 (ANTXR1) (NM_032208) Human Tagged ORF Clone
RC222030

USD 480.00

In Stock

ANTXR1 (Myc-DDK-tagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TEM8 (ANTXR1) (NM_018153) Human Tagged ORF Clone
RG204112

USD 460.00

In Stock

ANTXR1 (GFP-tagged) - Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TEM8 (ANTXR1) (NM_053034) Human Tagged ORF Clone
RG218473

USD 460.00

In Stock

ANTXR1 (GFP-tagged) - Human anthrax toxin receptor 1 (ANTXR1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TEM8 (ANTXR1) (NM_018153) Human Tagged ORF Clone
RC204112L3

USD 620.00

3 Weeks

Lenti ORF clone of Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TEM8 (ANTXR1) (NM_018153) Human Tagged ORF Clone Lentiviral Particle
RC204112L3V

USD 820.00

5 Weeks

Lenti ORF particles, ANTXR1 (Myc-DDK tagged) - Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TEM8 (ANTXR1) (NM_018153) Human Tagged ORF Clone
RC204112L4

USD 620.00

3 Weeks

Lenti ORF clone of Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TEM8 (ANTXR1) (NM_053034) Human Tagged ORF Clone
RC218473L3

USD 620.00

3 Weeks

Lenti ORF clone of Human anthrax toxin receptor 1 (ANTXR1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TEM8 (ANTXR1) (NM_053034) Human Tagged ORF Clone Lentiviral Particle
RC218473L3V

USD 820.00

6 Weeks

Lenti ORF particles, ANTXR1 (Myc-DDK tagged) - Human anthrax toxin receptor 1 (ANTXR1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TEM8 (ANTXR1) (NM_053034) Human Tagged ORF Clone
RC218473L4

USD 620.00

3 Weeks

Lenti ORF clone of Human anthrax toxin receptor 1 (ANTXR1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TEM8 (ANTXR1) (NM_032208) Human Tagged ORF Clone
RC222030L3

USD 680.00

3 Weeks

Lenti-ORF clone of ANTXR1 (Myc-DDK-tagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TEM8 (ANTXR1) (NM_032208) Human Tagged ORF Clone Lentiviral Particle
RC222030L3V

USD 880.00

5 Weeks

Lenti ORF particles, ANTXR1 (Myc-DDK-tagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TEM8 (ANTXR1) (NM_032208) Human Tagged ORF Clone
RC222030L4

USD 680.00

3 Weeks

Lenti-ORF clone of ANTXR1 (mGFP-tagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TEM8 (ANTXR1) (NM_018153) Human Tagged ORF Clone
RC204112L1

USD 768.00

In Stock

Lenti ORF clone of Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TEM8 (ANTXR1) (NM_032208) Human Tagged ORF Clone
RC222030L1

USD 840.00

In Stock

Lenti-ORF clone of ANTXR1 (Myc-DDK-tagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TEM8 (ANTXR1) (NM_032208) Human Untagged Clone
SC308755

USD 960.00

In Stock

ANTXR1 (untagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
TEM8 (ANTXR1) (NM_018153) Human Over-expression Lysate
LY413252

USD 396.00

5 Days

Transient overexpression lysate of anthrax toxin receptor 1 (ANTXR1), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TEM8 (ANTXR1) (NM_018153) Human Tagged ORF Clone
RC204112L2

USD 620.00

3 Weeks

Lenti ORF clone of Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TEM8 (ANTXR1) (NM_032208) Human Tagged ORF Clone
RC222030L2

USD 680.00

3 Weeks

Lenti-ORF clone of ANTXR1 (mGFP-tagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TEM8 (ANTXR1) (NM_018153) Human Untagged Clone
SC321448

USD 310.00

In Stock

ANTXR1 (untagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
TEM8 (ANTXR1) Rabbit Polyclonal Antibody
TA306121

USD 430.00

5 Days

Rabbit Polyclonal ATR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATR antibody was raised against a peptide corresponding to 13 amino acids near the center of human ATR.
TEM8 (ANTXR1) (NM_053034) Human Over-expression Lysate
LC409333

USD 121.00

In Stock

ANTXR1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TEM8 (ANTXR1) (NM_018153) Human Over-expression Lysate
LC413252

USD 121.00

In Stock

ANTXR1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TEM8 (ANTXR1) (NM_053034) Human Over-expression Lysate
LY409333

USD 396.00

5 Days

Transient overexpression lysate of anthrax toxin receptor 1 (ANTXR1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TEM8 (ANTXR1) Rabbit Polyclonal Antibody
TA306122

USD 430.00

5 Days

Rabbit Polyclonal ATR Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATR antibody was raised against a peptide corresponding to 13 amino acids near the C-terminus of human ATR.
TEM8 (ANTXR1) Goat Polyclonal Antibody
TA302960

USD 375.00

5 Days

Goat Polyclonal Antibody against ANTXR1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RAPPPSRPPPRPSV, from the C Terminus of the protein sequence according to NP_115584.
TEM8 (ANTXR1) Rabbit Polyclonal Antibody
TA318947

USD 355.00

3 Weeks

Rabbit polyclonal anti-TEM-8/ATR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 484 of Mouse TEM8
TEM8 (ANTXR1) Rabbit Polyclonal Antibody
TA339602

USD 375.00

5 Days

Rabbit Polyclonal Anti-ANTXR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANTXR1 antibody: synthetic peptide directed towards the middle region of human ANTXR1. Synthetic peptide located within the following region: VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK
TEM8 (ANTXR1) (NM_018153) Human Mass Spec Standard
PH304112

USD 2,055.00

3 Weeks

ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_060623)

Tag C-Myc/DDK
Expression Host HEK293
TEM8 (ANTXR1) (NM_053034) Human Mass Spec Standard
PH318473

USD 2,055.00

3 Weeks

ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_444262)

Tag C-Myc/DDK
Expression Host HEK293
TEM8 (ANTXR1) (NM_053034) Human Untagged Clone
SC110684

USD 630.00

4 Weeks

ANTXR1 (untagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
TEM8 (ANTXR1) Rabbit Polyclonal Antibody
TA322295

USD 345.00

In Stock

Anti-ANTXR1 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-332 amino acids of human anthrax toxin receptor 1
TEM8 (ANTXR1) Rabbit Polyclonal Antibody
TA322296

USD 345.00

In Stock

Anti-ANTXR1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
TEM8 (ANTXR1) (NM_018153) ICC Control Block
TB404112

USD 1,070.00

4 Weeks

Transient overexpression of ANTXR1 (NM_018153) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TEM8 (ANTXR1) (NM_053034) ICC Control Block
TB418473

USD 1,070.00

4 Weeks

Transient overexpression of ANTXR1 (NM_053034) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TEM8 (ANTXR1) (NM_032208) ICC Control Block
TB422030

USD 1,130.00

4 Weeks

Transient overexpression of ANTXR1 (NM_032208) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TEM8 (ANTXR1) Cytosection
TS404112

USD 225.00

4 Weeks

Transient overexpression of ANTXR1 (NM_018153) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TEM8 (ANTXR1) Cytosection
TS404112P5

USD 889.00

4 Weeks

Transient overexpression of ANTXR1 (NM_018153) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TEM8 (ANTXR1) Cytosection
TS418473

USD 225.00

4 Weeks

Transient overexpression of ANTXR1 (NM_053034) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack