Germany
Japan
United Kingdom
China
APOB (Myc-DDK-tagged)-Human apolipoprotein B (including Ag(x) antigen) (APOB)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadUSD 5,880.00
3 Weeks
Lenti ORF particles, APOB (Myc-DDK tagged) - Human apolipoprotein B (including Ag(x) antigen) (APOB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
APOB (GFP-tagged) - Human apolipoprotein B (including Ag(x) antigen) (APOB)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Apolipoprotein B / Apo B (APOB 100) human protein, 1 mg
| Protein Source | Plasma |
Apolipoprotein B (APOB) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | ApoLipoprotein Type B was isolated from human plasma by density gradient centrifugation followed by HPLC purification, |
Rabbit Polyclonal Anti-APOB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOB antibody: synthetic peptide directed towards the middle region of human APOB. Synthetic peptide located within the following region: SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV |
Apolipoprotein B (APOB) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Affinity purified Apolipoprotein-B (hLDL) |
Apolipoprotein B / Apo B human protein, 0.5 mg
| Protein Source | Plasma |
Goat Anti-APOB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TDLHLRYQKDKK, from the internal region of the protein sequence according to NP_000375.2. |
APOB (untagged)-Human apolipoprotein B (including Ag(x) antigen) (APOB)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anti-APOB Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2158-2177 amino acids of human apolipoprotein B (including Ag(x) antigen) |
Transient overexpression of APOB (NM_000384) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of APOB (NM_000384) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of APOB (NM_000384) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- APOB
Families
- Transmembrane