Products

cDNA Clones (14)
Proteins (8)
Antibodies (7)
Jump to Filters
View as table Download
TAPA1 (CD81) (NM_004356) Human Tagged ORF Clone
RG217508

USD 460.00

In Stock

CD81 (GFP-tagged) - Human CD81 molecule (CD81)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAPA1 (CD81) Rabbit Polyclonal Antibody
TA343281

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CD81 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE
TAPA1 (CD81) Mouse Monoclonal Antibody [Clone ID: M38]
AM26031RP-N

USD 300.00

2 Weeks

TAPA1 (CD81) mouse monoclonal antibody, clone M38, PE

Applications FC
Reactivities Feline, Human, Rabbit
Conjugation PE
TAPA1 (CD81) (NM_004356) Human Tagged ORF Clone
RC217508L3

USD 620.00

3 Weeks

Lenti ORF clone of Human CD81 molecule (CD81), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAPA1 (CD81) (NM_004356) Human Tagged ORF Clone
RC217508L4

USD 620.00

In Stock

Lenti ORF clone of Human CD81 molecule (CD81), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAPA1 (CD81) (NM_001297649) Human Tagged ORF Clone
RC236199

USD 420.00

2 Weeks

CD81 (myc-DDK-tagged) - Human CD81 molecule (CD81), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TAPA1 (CD81) Mouse Monoclonal Antibody [Clone ID: M38]
AM26031PU-N

USD 240.00

2 Weeks

TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified

Applications FC, FN, IF, IHC, IP, WB
Reactivities Feline, Human, Rabbit
TAPA1 (CD81) (NM_004356) Human Untagged Clone
SC117455

USD 420.00

In Stock

CD81 (untagged)-Human CD81 molecule (CD81)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TAPA1 (CD81) (NM_004356) Human Over-expression Lysate
LC418041

USD 121.00

In Stock

CD81 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TAPA1 (CD81) Rabbit Polyclonal Antibody
TA306789

USD 430.00

2 Weeks

Rabbit Polyclonal CD81 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CD81 antibody was raised against a 20 amino acid peptide near the amino terminus of human CD81.
TAPA1 (CD81) Mouse Monoclonal Antibody [Clone ID: 1D6]
TA336485

USD 424.00

5 Days

Mouse Monoclonal CD81 Antibody (1D6)

Applications FC, IHC, WB
Reactivities Human, Goat, Primate, Sheep
Conjugation Unconjugated
TAPA1 (CD81) (NM_001297649) Human Untagged Clone
SC334093

USD 310.00

In Stock

CD81 (untagged) - Human CD81 molecule (CD81), transcript variant 2

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
TAPA1 (CD81) (NM_004356) Human Tagged ORF Clone
RC217508L2

USD 620.00

3 Weeks

Lenti ORF clone of Human CD81 molecule (CD81), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TAPA1 (CD81) Mouse Monoclonal Antibody [Clone ID: M38]
AM26031FC-N

USD 270.00

2 Weeks

TAPA1 (CD81) mouse monoclonal antibody, clone M38, FITC

Applications FC
Reactivities Feline, Human, Rabbit
Conjugation FITC
TAPA1 (CD81) Rabbit Polyclonal Antibody
AP31748PU-N

USD 440.00

2 Weeks

TAPA1 (CD81) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide
TAPA1 (CD81) (NM_004356) Human Mass Spec Standard
PH317508

USD 2,055.00

3 Weeks

CD81 MS Standard C13 and N15-labeled recombinant protein (NP_004347)

Tag C-Myc/DDK
Expression Host HEK293
TAPA1 (CD81) (NM_001297649) Human Tagged ORF Clone
RG236199

USD 460.00

2 Weeks

CD81 (GFP-tagged) - Human CD81 molecule (CD81), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAPA1 (CD81) ICC Control Block
TB417508

USD 1,070.00

4 Weeks

Transient overexpression of CD81 (NM_004356) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAPA1 (CD81) ICC Control Block
TB436199

USD 1,070.00

4 Weeks

Transient overexpression of CD81 (NM_001297649) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAPA1 (CD81) Cytosection
TS417508

USD 225.00

4 Weeks

Transient overexpression of CD81 (NM_004356) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TAPA1 (CD81) Cytosection
TS417508P5

USD 889.00

4 Weeks

Transient overexpression of CD81 (NM_004356) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TAPA1 (CD81) ICC Control Sections
TS436199P5

USD 889.00

4 Weeks

Transient overexpression of CD81 (NM_001297649) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack