Germany
Japan
United Kingdom
China
CD99L2 (Myc-DDK-tagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CD99L2 (Myc-DDK-tagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human CD99 molecule-like 2 (CD99L2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CD99L2 (GFP-tagged) - Human CD99 molecule-like 2 (CD99L2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human CD99 molecule-like 2 (CD99L2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CD99L2 (Myc-DDK tagged) - Human CD99 molecule-like 2 (CD99L2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CD99 molecule-like 2 (CD99L2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CD99L2 (mGFP-tagged) - Human CD99 molecule-like 2 (CD99L2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CD99L2 (Myc-DDK-tagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of CD99L2 (Myc-DDK-tagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CD99L2 (Myc-DDK-tagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CD99L2 (mGFP-tagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CD99L2 (mGFP-tagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CD99L2 (Myc-DDK-tagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of CD99L2 (Myc-DDK-tagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CD99L2 (Myc-DDK-tagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CD99L2 (mGFP-tagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CD99L2 (mGFP-tagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CD99 molecule-like 2 (CD99L2), transcript variant 4, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CD99L2 (Myc-DDK tagged) - Human CD99 molecule-like 2 (CD99L2), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CD99 molecule-like 2 (CD99L2), transcript variant 4, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CD99L2 (mGFP-tagged) - Human CD99 molecule-like 2 (CD99L2), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CD99L2 (Myc-DDK tagged) - Homo sapiens CD99 molecule-like 2 (CD99L2), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CD99L2 (GFP-tagged) - Human CD99 molecule-like 2 (CD99L2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CD99L2 (GFP-tagged) - Human CD99 molecule-like 2 (CD99L2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CD99L2 (GFP-tagged) - Human CD99 molecule-like 2 (CD99L2), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CD99L2 (GFP-tagged) - Homo sapiens CD99 molecule-like 2 (CD99L2), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Transient overexpression lysate of CD99 molecule-like 2 (CD99L2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Purified recombinant protein of Human CD99 molecule-like 2 (CD99L2), transcript variant 1
| Tag | C-His |
| Expression Host | HEK293 |
CD99L2 (untagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CD99L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD99L2 antibody: synthetic peptide directed towards the middle region of human CD99L2. Synthetic peptide located within the following region: RNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPG |
CD99L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CD99L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of CD99 molecule-like 2 (CD99L2), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CD99L2 MS Standard C13 and N15-labeled recombinant protein (NP_113650)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CD99L2 (untagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
CD99L2 (untagged)-Human CD99 molecule-like 2 (CD99L2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
CD99L2 (untagged)-Human CD99 molecule-like 2 (CD99L2) transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CD99L2 (untagged) - Homo sapiens CD99 molecule-like 2 (CD99L2), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
CD99L2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of CD99L2 (NM_031462) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CD99L2 (NM_134445) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CD99L2 (NM_134446) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CD99L2 (NM_001184808) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CD99L2 (NM_001242614) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human CD99 molecule-like 2 (CD99L2), transcript variant 1
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human CD99 molecule-like 2 (CD99L2), transcript variant 1
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human CD99 molecule-like 2 (CD99L2), transcript variant 1
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of CD99L2 (NM_031462) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CD99L2 (NM_031462) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CD99L2
Families
- Transmembrane