Products

cDNA Clones (26)
Proteins (17)
Antibodies (5)
Jump to Filters
View as table Download
HSD11B1 (NM_005525) Human Tagged ORF Clone
RC203109

USD 420.00

In Stock

HSD11B1 (Myc-DDK-tagged)-Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HSD11B1 (NM_181755) Human Tagged ORF Clone
RC212093

USD 420.00

In Stock

HSD11B1 (Myc-DDK-tagged)-Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HSD11B1 (NM_005525) Human Tagged ORF Clone Lentiviral Particle
RC203109L1V

USD 820.00

6 Weeks

Lenti ORF particles, HSD11B1 (Myc-DDK tagged) - Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
HSD11B1 (NM_005525) Human Tagged ORF Clone Lentiviral Particle
RC203109L2V

USD 820.00

6 Weeks

Lenti ORF particles, HSD11B1 (mGFP-tagged) - Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
HSD11B1 (NM_181755) Human Tagged ORF Clone Lentiviral Particle
RC212093L1V

USD 820.00

3 Weeks

Lenti ORF particles, HSD11B1 (Myc-DDK tagged) - Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
HSD11B1 (NM_181755) Human Tagged ORF Clone Lentiviral Particle
RC212093L2V

USD 820.00

6 Weeks

Lenti ORF particles, HSD11B1 (mGFP-tagged) - Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
HSD11B1 (NM_001206741) Human Tagged ORF Clone
RC232389

USD 420.00

In Stock

HSD11B1 (Myc-DDK tagged) - Homo sapiens hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HSD11B1 (NM_005525) Human Tagged ORF Clone
RG203109

USD 460.00

In Stock

HSD11B1 (GFP-tagged) - Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HSD11B1 (NM_181755) Human Tagged ORF Clone
RG212093

USD 460.00

In Stock

HSD11B1 (GFP-tagged) - Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HSD11B1 (NM_005525) Human Tagged ORF Clone
RC203109L3

USD 620.00

3 Weeks

Lenti ORF clone of Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HSD11B1 (NM_005525) Human Tagged ORF Clone Lentiviral Particle
RC203109L3V

USD 820.00

6 Weeks

Lenti ORF particles, HSD11B1 (Myc-DDK tagged) - Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HSD11B1 (NM_005525) Human Tagged ORF Clone Lentiviral Particle
RC203109L4V

USD 820.00

3 Weeks

Lenti ORF particles, HSD11B1 (mGFP-tagged) - Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HSD11B1 (NM_181755) Human Tagged ORF Clone
RC212093L3

USD 620.00

3 Weeks

Lenti ORF clone of Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HSD11B1 (NM_181755) Human Tagged ORF Clone Lentiviral Particle
RC212093L3V

USD 820.00

5 Weeks

Lenti ORF particles, HSD11B1 (Myc-DDK tagged) - Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HSD11B1 (NM_181755) Human Tagged ORF Clone
RC212093L4

USD 620.00

3 Weeks

Lenti ORF clone of Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HSD11B1 (NM_181755) Human Tagged ORF Clone Lentiviral Particle
RC212093L4V

USD 820.00

7 Weeks

Lenti ORF particles, HSD11B1 (mGFP-tagged) - Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HSD11B1 (NM_001206741) Human Tagged ORF Clone
RG232389

USD 460.00

3 Weeks

HSD11B1 (GFP-tagged) - Homo sapiens hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HSD11B1 (NM_005525) Human Untagged Clone
SC109325

USD 310.00

In Stock

HSD11B1 (untagged)-Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HSD11B1 (NM_005525) Human Tagged Lenti ORF Clone
RC203109L4

USD 768.00

In Stock

Lenti ORF clone of Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HSD11B1 (NM_181755) Human Tagged ORF Clone
RC212093L1

USD 768.00

In Stock

Lenti ORF clone of Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
HSD11B1 (NM_005525) Human Over-expression Lysate
LY401695

USD 396.00

In Stock

Transient overexpression lysate of hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HSD11B1 (NM_181755) Human Over-expression Lysate
LY405624

USD 396.00

In Stock

Transient overexpression lysate of hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HSD11B1 Goat Polyclonal Antibody
TA302508

USD 375.00

5 Days

Goat Polyclonal Antibody against HSD11B1 / HDL

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CTSYNMDRFINK, from the C Terminus of the protein sequence according to NP_005516.1; NP_861420.1.
HSD11B1 Rabbit Polyclonal Antibody
TA308504

USD 415.00

5 Days

Rabbit polyclonal antibody to HSD11B1 (hydroxysteroid (11-beta) dehydrogenase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 232 and 292 of HSD11B1
HSD11B1 (NM_181755) Human Over-expression Lysate
LC405624

USD 121.00

In Stock

HSD11B1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HSD11B1 (NM_005525) Human Untagged Clone
SC321065

USD 310.00

In Stock

HSD11B1 (untagged)-Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
HSD11B1 (NM_181755) Human Untagged Clone
SC107341

USD 660.00

In Stock

HSD11B1 (untagged)-Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
HSD11B1 Rabbit Polyclonal Antibody
TA312234

USD 345.00

In Stock

Rabbit polyclonal anti-HSD11B1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HSD11B1.
HSD11B1 (NM_005525) Human Over-expression Lysate
LC401695

USD 121.00

In Stock

HSD11B1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
HSD11B1 (NM_005525) Human Tagged ORF Clone
RC203109L1

USD 620.00

3 Weeks

Lenti ORF clone of Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
HSD11B1 (NM_005525) Human Tagged ORF Clone
RC203109L2

USD 620.00

3 Weeks

Lenti ORF clone of Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
HSD11B1 (NM_181755) Human Tagged ORF Clone
RC212093L2

USD 620.00

3 Weeks

Lenti ORF clone of Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
HSD11B1 Rabbit Polyclonal Antibody
AP31830PU-N

USD 440.00

2 Weeks

HSD11B1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide
HSD11B1 Rabbit Polyclonal Antibody
TA338149

USD 375.00

5 Days

Rabbit Polyclonal Anti-HSD11B1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD11B1 antibody: synthetic peptide directed towards the N terminal of human HSD11B1. Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
HSD11B1 (NM_005525) Human Mass Spec Standard
PH303109

USD 2,055.00

3 Weeks

HSD11B1 MS Standard C13 and N15-labeled recombinant protein (NP_005516)

Tag C-Myc/DDK
Expression Host HEK293
HSD11B1 (NM_181755) Human Mass Spec Standard
PH312093

USD 2,055.00

3 Weeks

HSD11B1 MS Standard C13 and N15-labeled recombinant protein (NP_861420)

Tag C-Myc/DDK
Expression Host HEK293
HSD11B1 (NM_001206741) Human Untagged Clone
SC329835

USD 310.00

3 Weeks

HSD11B1 (untagged) - Homo sapiens hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 3

Vector pCMV6 series
Tag Tag Free
HSD11B1 ICC Control Block
TB403109

USD 1,070.00

4 Weeks

Transient overexpression of HSD11B1 (NM_005525) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HSD11B1 ICC Control Block
TB412093

USD 1,070.00

4 Weeks

Transient overexpression of HSD11B1 (NM_181755) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HSD11B1 ICC Control Block
TB432389

USD 1,070.00

4 Weeks

Transient overexpression of HSD11B1 (NM_001206741) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HSD11B1 Cytosection
TS403109

USD 225.00

4 Weeks

Transient overexpression of HSD11B1 (NM_005525) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HSD11B1 Cytosection
TS403109P5

USD 889.00

4 Weeks

Transient overexpression of HSD11B1 (NM_005525) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

HSD11B1 Cytosection
TS412093

USD 225.00

4 Weeks

Transient overexpression of HSD11B1 (NM_181755) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HSD11B1 Cytosection
TS412093P5

USD 889.00

4 Weeks

Transient overexpression of HSD11B1 (NM_181755) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

HSD11B1 Cytosection
TS432389

USD 225.00

4 Weeks

Transient overexpression of HSD11B1 (NM_001206741) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HSD11B1 Cytosection
TS432389P5

USD 889.00

4 Weeks

Transient overexpression of HSD11B1 (NM_001206741) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack