Products

cDNA Clones (30)
Proteins (12)
Antibodies (4)
Jump to Filters
View as table Download
NOX5 (NM_024505) Human Tagged ORF Clone
RC214207

USD 850.00

In Stock

NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NOX5 (NM_001184780) Human Tagged ORF Clone
RC230463

USD 610.00

In Stock

NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NOX5 (NM_001184779) Human Tagged ORF Clone
RC230471

USD 810.00

In Stock

NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NOX5 (NM_001184780) Human Tagged ORF Clone Lentiviral Particle
RC230463L1V

USD 1,010.00

6 Weeks

Lenti ORF particles, NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NOX5 (NM_024505) Human Tagged ORF Clone Lentiviral Particle
RC214207L1V

USD 1,250.00

3 Weeks

Lenti ORF particles, NOX5 (Myc-DDK tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NOX5 (NM_024505) Human Tagged ORF Clone Lentiviral Particle
RC214207L2V

USD 1,250.00

6 Weeks

Lenti ORF particles, NOX5 (mGFP-tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NOX5 (NM_001184780) Human Tagged ORF Clone Lentiviral Particle
RC230463L2V

USD 1,010.00

6 Weeks

Lenti ORF particles, NOX5 (mGFP-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NOX5 (NM_024505) Human Tagged ORF Clone
RG214207

USD 940.00

In Stock

NOX5 (GFP-tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NOX5 (NM_024505) Human Tagged ORF Clone Lentiviral Particle
RC214207L3V

USD 1,250.00

5 Weeks

Lenti ORF particles, NOX5 (Myc-DDK tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NOX5 (NM_024505) Human Tagged ORF Clone
RC214207L4

USD 1,050.00

In Stock

Lenti ORF clone of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NOX5 (NM_024505) Human Tagged ORF Clone Lentiviral Particle
RC214207L4V

USD 1,250.00

3 Weeks

Lenti ORF particles, NOX5 (mGFP-tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NOX5 (NM_001184780) Human Tagged ORF Clone
RC230463L3

USD 810.00

3 Weeks

Lenti-ORF clone of NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NOX5 (NM_001184780) Human Tagged ORF Clone Lentiviral Particle
RC230463L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NOX5 (NM_001184780) Human Tagged ORF Clone
RC230463L4

USD 810.00

3 Weeks

Lenti-ORF clone of NOX5 (mGFP-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NOX5 (NM_001184780) Human Tagged ORF Clone Lentiviral Particle
RC230463L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, NOX5 (mGFP-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NOX5 (NM_001184779) Human Tagged ORF Clone
RC230471L3

USD 1,010.00

3 Weeks

Lenti ORF clone of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NOX5 (NM_001184779) Human Tagged ORF Clone Lentiviral Particle
RC230471L3V

USD 1,210.00

6 Weeks

Lenti ORF particles, NOX5 (Myc-DDK tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NOX5 (NM_001184779) Human Tagged ORF Clone
RC230471L4

USD 1,010.00

3 Weeks

Lenti ORF clone of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NOX5 (NM_001184779) Human Tagged ORF Clone Lentiviral Particle
RC230471L4V

USD 1,210.00

6 Weeks

Lenti ORF particles, NOX5 (mGFP-tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NOX5 (NM_001184780) Human Tagged ORF Clone
RG230463

USD 670.00

3 Weeks

NOX5 (GFP-tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NOX5 (NM_001184779) Human Tagged ORF Clone
RG230471

USD 890.00

3 Weeks

NOX5 (GFP-tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NOX5 (NM_024505) Human Over-expression Lysate
LY402996

USD 605.00

In Stock

Transient overexpression lysate of NADPH oxidase, EF-hand calcium binding domain 5 (NOX5)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NOX5 (NM_024505) Human Tagged Lenti ORF Clone
RC214207L3

USD 1,296.00

3 Weeks

Lenti ORF clone of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NOX5 (NM_024505) Human Tagged ORF Clone
RC214207L1

USD 1,050.00

In Stock

Lenti ORF clone of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NOX5 (NM_024505) Human Over-expression Lysate
LC402996

USD 187.00

2 Weeks

NOX5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NOX5 (NM_024505) Human Untagged Clone
SC123954

USD 1,560.00

In Stock

NOX5 (untagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
NOX5 Rabbit Polyclonal Antibody
TA315785

USD 345.00

4 Weeks

Rabbit polyclonal anti-NOX5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human NOX5.
NOX5 (NM_024505) Human Tagged ORF Clone
RC214207L2

USD 1,050.00

3 Weeks

Lenti ORF clone of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NOX5 (NM_001184780) Human Tagged ORF Clone
RC230463L1

USD 810.00

3 Weeks

Lenti-ORF clone of NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NOX5 (NM_001184780) Human Tagged ORF Clone
RC230463L2

USD 810.00

3 Weeks

Lenti-ORF clone of NOX5 (mGFP-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NOX5 (NM_001184779) Human Untagged Clone
SC329109

USD 1,490.00

In Stock

NOX5 (untagged)-Human NADPH oxidase EF-hand calcium binding domain 5 (NOX5) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
NOX5 Goat Polyclonal Antibody
TA311523

USD 375.00

5 Days

Goat Anti-NOX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EWHPFTISSAPEQKD, from the internal region of the protein sequence according to NP_078781.3; NP_001171708.1; NP_001171709.1.
NOX5 Rabbit Polyclonal Antibody
TA338656

USD 375.00

5 Days

Rabbit Polyclonal Anti-NOX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human NOX5. Synthetic peptide located within the following region: DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITG
NOX5 (NM_024505) Human Untagged Clone
SC318228

USD 1,560.00

3 Weeks

NOX5 (untagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
NOX5 (NM_001184780) Human Untagged Clone
SC329101

USD 760.00

5 Weeks

NOX5 (untagged)-Human NADPH oxidase EF-hand calcium binding domain 5 (NOX5) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NOX5 Rabbit Polyclonal Antibody
TA350234

USD 345.00

In Stock

Rabbit Polyclonal Anti-NOX5 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NOX5
NOX5 (NM_024505) ICC Control Block
TB414207

USD 1,500.00

4 Weeks

Transient overexpression of NOX5 (NM_024505) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NOX5 (NM_001184780) ICC Control Block
TB430463

USD 1,260.00

4 Weeks

Transient overexpression of NOX5 (NM_001184780) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NOX5 (NM_001184779) ICC Control Block
TB430471

USD 1,460.00

4 Weeks

Transient overexpression of NOX5 (NM_001184779) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NOX5 (NM_001184779) Human Recombinant Protein
TP762384

USD 205.00

2 Weeks

Purified recombinant protein of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2, Val418-His530, with N-terminal His-ABP tag, expressed in E.coli, 50ug

Tag N-His ABP
Expression Host E. coli
NOX5 Cytosection
TS414207

USD 225.00

4 Weeks

Transient overexpression of NOX5 (NM_024505) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

NOX5 Cytosection
TS414207P5

USD 889.00

4 Weeks

Transient overexpression of NOX5 (NM_024505) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

NOX5 Cytosection
TS430463

USD 225.00

4 Weeks

Transient overexpression of NOX5 (NM_001184780) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

NOX5 Cytosection
TS430463P5

USD 889.00

4 Weeks

Transient overexpression of NOX5 (NM_001184780) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

NOX5 Cytosection
TS430471

USD 225.00

4 Weeks

Transient overexpression of NOX5 (NM_001184779) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

NOX5 Cytosection
TS430471P5

USD 889.00

4 Weeks

Transient overexpression of NOX5 (NM_001184779) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack