Germany
Japan
United Kingdom
China
NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NOX5 (Myc-DDK tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NOX5 (mGFP-tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, NOX5 (mGFP-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
NOX5 (GFP-tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NOX5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN414207 is the updated version of KN214207.
Lenti ORF particles, NOX5 (Myc-DDK tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NOX5 (mGFP-tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NOX5 (mGFP-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NOX5 (mGFP-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NOX5 (Myc-DDK tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NOX5 (mGFP-tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NOX5 (GFP-tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NOX5 (GFP-tagged) - Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Transient overexpression lysate of NADPH oxidase, EF-hand calcium binding domain 5 (NOX5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
NOX5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NOX5 (untagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-NOX5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX5. |
NOX5 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Lenti ORF clone of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of NOX5 (Myc-DDK-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of NOX5 (mGFP-tagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 3
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
NOX5 (untagged)-Human NADPH oxidase EF-hand calcium binding domain 5 (NOX5) transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NOX5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Goat Anti-NOX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EWHPFTISSAPEQKD, from the internal region of the protein sequence according to NP_078781.3; NP_001171708.1; NP_001171709.1. |
qSTAR qPCR primer pairs against Homo sapiens gene NOX5
Rabbit Polyclonal Anti-NOX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human NOX5. Synthetic peptide located within the following region: DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITG |
NOX5 CRISPRa kit - CRISPR gene activation of human NADPH oxidase 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene NOX5
| Application | Plasmid of exact quantity for transcript copy number calculation |
NOX5 (untagged)-Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NOX5 (untagged)-Human NADPH oxidase EF-hand calcium binding domain 5 (NOX5) transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-NOX5 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NOX5 |
NOX5 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NOX5 |
NOX5 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 661-765 of human NOX5 (NP_078781.3). |
| Modifications | Unmodified |
Transient overexpression of NOX5 (NM_024505) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NOX5 (NM_001184780) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NOX5 (NM_001184779) in HEK293T cells paraffin embedded controls for ICC/IHC staining
NOX5 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
NOX5 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Human NADPH oxidase, EF-hand calcium binding domain 5 (NOX5), transcript variant 2, Val418-His530, with N-terminal His-ABP tag, expressed in E.coli, 50ug
| Tag | N-His ABP |
| Expression Host | E. coli |
Active filters
Target Symbol
- NOX5