Germany
Japan
United Kingdom
China
NT5C3 (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
NT5C3 (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
NT5C3 (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
NT5C3 (GFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NT5C3 (GFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, NT5C3A (Myc-DDK tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, NT5C3A (mGFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, NT5C3A (Myc-DDK tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, NT5C3A (mGFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, NT5C3A (Myc-DDK tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, NT5C3A (mGFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NT5C3 (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of NT5C3 (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 4
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, NT5C3 (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NT5C3 (mGFP-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 4
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, NT5C3 (mGFP-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NT5C3 (GFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NT5C3 (GFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NT5C3 (untagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-NT5C3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5C3 Antibody: A synthesized peptide derived from human NT5C3 |
NT5C3A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NT5C3 (untagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
NT5C3 (untagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY424319 is the same product as LY425069.
Rabbit Polyclonal Anti-NT5C3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3. Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII |
NT5C3A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NT5C3A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NT5C3A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_057573)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_001002009)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
NT5C3 (untagged)-Human 5'-nucleotidase cytosolic III (NT5C3) transcript variant 4
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression of NT5C3A (NM_016489) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C3A (NM_001002009) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C3A (NM_001002010) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C3A (NM_001166118) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C3A (NM_016489) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NT5C3A (NM_016489) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NT5C3A (NM_001002009) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NT5C3A (NM_001002009) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- NT5C3A
Families
- Transmembrane