Germany
Japan
United Kingdom
China
TNFRSF21 (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, TNFRSF21 (Myc-DDK tagged) - Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, TNFRSF21 (mGFP-tagged) - Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TNFRSF21 (GFP-tagged) - Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
5 Weeks
Lenti ORF particles, TNFRSF21 (Myc-DDK tagged) - Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, TNFRSF21 (mGFP-tagged) - Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TNFRSF21 (untagged)-Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-Tnfrsf21 (DR6) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 622 of rat DR6 |
TNFRSF21 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal DR6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DR6 antibody was raised against a peptide corresponding to amino acids 42 to 56 of human DR6 precursor . |
Rabbit Polyclonal Anti-TNFRSF21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF21 antibody: synthetic peptide directed towards the N terminal of human TNFRSF21. Synthetic peptide located within the following region: TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-His |
| Expression Host | HEK293 |
Anti-TNFRSF21 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 42-56 amino acids of Human tumor necrosis factor receptor superfamily, member 21 |
Transient overexpression of TNFRSF21 (NM_014452) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-Fc |
| Expression Host | HEK293 |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-Fc |
| Expression Host | HEK293 |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-Fc |
| Expression Host | HEK293 |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-Fc |
| Expression Host | HEK293 |
Transient overexpression of TNFRSF21 (NM_014452) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TNFRSF21 (NM_014452) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TNFRSF21
Families
- Transmembrane