Germany
Japan
United Kingdom
China
TNFRSF21 (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, TNFRSF21 (Myc-DDK tagged) - Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, TNFRSF21 (mGFP-tagged) - Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Tnfrsf21 (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 21 (Tnfrsf21)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tnfrsf21 (Myc-DDK-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 21 (Tnfrsf21), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TNFRSF21 (GFP-tagged) - Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TNFRSF21 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405864 is the updated version of KN205864.
Tnfrsf21 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN517985 is the updated version of KN317985.
Tnfrsf21 (GFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 21 (Tnfrsf21)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tnfrsf21 (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 21 (Tnfrsf21)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfrsf21 (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 21 (Tnfrsf21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfrsf21 (mGFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 21 (Tnfrsf21)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfrsf21 (GFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 21 (Tnfrsf21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
5 Weeks
Lenti ORF particles, TNFRSF21 (Myc-DDK tagged) - Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, TNFRSF21 (mGFP-tagged) - Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfrsf21 (Myc-DDK-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 21 (Tnfrsf21), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfrsf21 (Myc-DDK-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 21 (Tnfrsf21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfrsf21 (mGFP-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 21 (Tnfrsf21), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfrsf21 (GFP-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 21 (Tnfrsf21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TNFRSF21 (untagged)-Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Tnfrsf21 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Tnfrsf21 (untagged) - Mouse tumor necrosis factor receptor superfamily, member 21 (cDNA clone MGC:25901 IMAGE:4220624), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-Tnfrsf21 (DR6) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 622 of rat DR6 |
TNFRSF21 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Tnfrsf21 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal DR6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DR6 antibody was raised against a peptide corresponding to amino acids 42 to 56 of human DR6 precursor . |
3`UTR clone of tumor necrosis factor receptor superfamily member 21 (TNFRSF21) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Rabbit Polyclonal Anti-TNFRSF21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF21 antibody: synthetic peptide directed towards the N terminal of human TNFRSF21. Synthetic peptide located within the following region: TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-His |
| Expression Host | HEK293 |
For quantitative detection of human TNFRSF21 in cell culture supernates, serum and plasma (heparin, EDTA, citrate).
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human TNFRSF21/DR6 |
| Format | 8x12 divisible strips |
| Reactivities | Human |
TNFRSF21 CRISPRa kit - CRISPR gene activation of human TNF receptor superfamily member 21
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene TNFRSF21
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene TNFRSF21
qSTAR qPCR primer pairs against Mus musculus gene Tnfrsf21
Tnfrsf21 (untagged ORF) - Rat tumor necrosis factor receptor superfamily, member 21 (Tnfrsf21), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Tnfrsf21 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-TNFRSF21 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 42-56 amino acids of Human tumor necrosis factor receptor superfamily, member 21 |
Transient overexpression of TNFRSF21 (NM_014452) in HEK293T cells paraffin embedded controls for ICC/IHC staining
TNFRSF21 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
TNFRSF21 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Tnfrsf21 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Tnfrsf21 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Tnfrsf21 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
| Tag | C-Fc |
| Expression Host | HEK293 |
Active filters
Target Symbol
- TNFRSF21