Products

cDNA Clones (10)
Antibodies (8)
Proteins (5)
Jump to Filters
View as table Download
TWEAK (TNFSF12) (NM_003809) Human Tagged ORF Clone
RC221007

USD 420.00

In Stock

TNFSF12 (Myc-DDK-tagged)-Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TWEAK (TNFSF12) (NM_003809) Human Tagged ORF Clone Lentiviral Particle
RC221007L1V

USD 820.00

6 Weeks

Lenti ORF particles, TNFSF12 (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
TWEAK (TNFSF12) (NM_003809) Human Tagged ORF Clone Lentiviral Particle
RC221007L2V

USD 820.00

6 Weeks

Lenti ORF particles, TNFSF12 (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
TWEAK (TNFSF12) (NM_003809) Human Tagged ORF Clone Lentiviral Particle
RC221007L3V

USD 820.00

6 Weeks

Lenti ORF particles, TNFSF12 (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TWEAK (TNFSF12) (NM_003809) Human Tagged ORF Clone Lentiviral Particle
RC221007L4V

USD 820.00

6 Weeks

Lenti ORF particles, TNFSF12 (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TWEAK (TNFSF12) (NM_003809) Human Tagged ORF Clone
RG221007

USD 460.00

3 Weeks

TNFSF12 (GFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TWEAK (TNFSF12) (NM_003809) Human Untagged Clone
SC303382

USD 420.00

In Stock

TNFSF12 (untagged)-Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
TWEAK (TNFSF12) (NM_003809) Human Tagged ORF Clone
RC221007L4

USD 768.00

In Stock

Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TWEAK (TNFSF12) Rabbit Polyclonal Antibody
TA314806

USD 345.00

In Stock

Rabbit polyclonal anti-TNF12 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNF12.
TWEAK (TNFSF12) Rabbit Polyclonal Antibody
TA306313

USD 430.00

2 Weeks

Rabbit Polyclonal TWEAK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen TWEAK antibody was raised against recombinant human TWEAK protein.
TNFSF12-TNFSF13 Rabbit Polyclonal Antibody
AP20513PU-N

USD 407.00

2 Weeks

TNFSF12-TNFSF13 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 51-100 of Human TWEAK.
TWEAK (TNFSF12) (NM_003809) Human Tagged ORF Clone
RC221007L1

USD 620.00

3 Weeks

Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TWEAK (TNFSF12) (NM_003809) Human Tagged ORF Clone
RC221007L2

USD 620.00

3 Weeks

Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TWEAK (TNFSF12) (NM_003809) Human Over-expression Lysate
LC418410

USD 121.00

In Stock

TNFSF12 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TWEAK (TNFSF12) Goat Polyclonal Antibody
TA328466

USD 285.00

5 Days

Biotinylated Anti-Human TWEAK Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Immunogen E.coli derived Recombinant Human TWEAK
TWEAK (TNFSF12) Goat Polyclonal Antibody
TA328467

USD 285.00

5 Days

Anti-Human TWEAK Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Immunogen E.coli derived Recombinant Human TWEAK
TWEAK (TNFSF12) Rabbit Polyclonal Antibody
TA330020

USD 375.00

5 Days

Rabbit Polyclonal Anti-TNFSF12 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA
TWEAK (TNFSF12) Rabbit Polyclonal Antibody
TA341640

USD 375.00

5 Days

Rabbit Polyclonal Anti-TNFSF12 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: LGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPF
TWEAK (TNFSF12) (NM_003809) ICC Control Block
TB421007

USD 1,070.00

4 Weeks

Transient overexpression of TNFSF12 (NM_003809) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TWEAK (TNFSF12) Cytosection
TS421007

USD 225.00

4 Weeks

Transient overexpression of TNFSF12 (NM_003809) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TWEAK (TNFSF12) Cytosection
TS421007P5

USD 889.00

4 Weeks

Transient overexpression of TNFSF12 (NM_003809) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack