Germany
Japan
United Kingdom
China
TNFSF15 (Myc-DDK-tagged)-Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, TNFSF15 (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, TNFSF15 (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TNFSF15 (GFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TNFSF15 (Myc-DDK tagged) - Homo sapiens tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, TNFSF15 (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, TNFSF15 (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TNFSF15 (GFP-tagged) - Homo sapiens tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TNFSF15 (untagged)-Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
TNFSF15 (untagged) - Homo sapiens tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1.
| Tag | Tag Free |
| Expression Host | E. coli |
Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TNFSF15 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Anti-Human TL-1A Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human TL-1A |
Rabbit Polyclonal anti-TNFSF15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TNFSF15 antibody is: synthetic peptide directed towards the C-terminal region of Human TNFSF15. Synthetic peptide located within the following region: CSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQP |
TNFSF15 (72-251, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
TNFSF15 (72-251, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression of TNFSF15 (NM_005118) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TNFSF15 (NM_001204344) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15) / isoform 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15) / isoform 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15) / isoform 2
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15) / isoform 2
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of TNFSF15 (NM_005118) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TNFSF15 (NM_005118) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TNFSF15 (NM_001204344) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TNFSF15 (NM_001204344) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TNFSF15
Families
- Transmembrane