Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Rabbit Polyclonal Anti-ACAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH |
Rabbit Polyclonal Anti-ACAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL |
Rabbit Polyclonal Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the phosphorylated serine 293 of the human Pyruvate Dehydrogenase E1-alpha subunit protein. [Swiss-Prot #P08559] |
Rabbit Polyclonal Anti-ACSM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSM3 antibody: synthetic peptide directed towards the C terminal of human ACSM3. Synthetic peptide located within the following region: DQEQLIKEIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEW |
Mouse Monoclonal pyruvate dehydrogenase (lipoamide) alpha 1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against HADH / HADHSC
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YERGDASKEDID, from the internal region of the protein sequence according to NP_005318.2. |
Goat Polyclonal Antibody against GAD2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLEDNEERMSRLSK, from the internal region of the protein sequence according to NP_000809.1. |
Goat Anti-GAD1 (isoform GAD67) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PDSPQRREKLHK, from the internal region of the protein sequence according to NP_000808.2. |
Rabbit Polyclonal Aldh5A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aldh5A1 antibody was raised against a 22 amino acid peptide near the carboxy terminus of the human Aldh5A1. |
Mouse anti-ACAT1 monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-ACAT1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Porcine, Rat, Murine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT1. |
Goat Anti-ACAT1 (aa253-266) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEEYKRVDFSKVPK, from the internal region of the protein sequence according to NP_000010.1. |
Goat Anti-ALDH1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKEQFERVLGYIQ, from the interral region of the protein sequence according to NP_000683.3. |
Goat Anti-ALDH5A1 (aa 301-312) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TGKILLHHAANS, from the internal region of the protein sequence according to NP_733936.1; NP_001071.1. |
Rabbit polyclonal anti-TFP1/HADHA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 750 of human TFP1 |
Anti-PDHA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 30-390 amino acids of human pyruvate dehydrogenase (lipoamide) alpha 1 |
Anti-GAD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 185 amino acids of human glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) |
Anti-GAD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.148~152 (E-L-A-D-Q) derived from Human GAD65 (GAD2). |
Anti-HADH Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit anti-GAD1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human GAD1 |
Rabbit Polyclonal Anti-ACSM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACSM4 Antibody is: synthetic peptide directed towards the N-terminal region of Human ACSM4. Synthetic peptide located within the following region: DQWSQKEKTGERPANPALWWVNGKGDEVKWSFRELGSLSRKAANVLTKPC |
Rabbit Polyclonal Anti-ACSM2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACSM2A Antibody is: synthetic peptide directed towards the C-terminal region of Human ACSM2A. Synthetic peptide located within the following region: SYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSK |
Rabbit Polyclonal Anti-ACSM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACSM3 Antibody is: synthetic peptide directed towards the middle region of Human ACSM3. Synthetic peptide located within the following region: EPITPDVTEKWRNKTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPS |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR |
Rabbit Polyclonal Anti-PDHA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDHA2 Antibody: synthetic peptide directed towards the N terminal of human PDHA2. Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GAD1 Antibody: synthetic peptide directed towards the N terminal of human GAD1. Synthetic peptide located within the following region: MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF |
Rabbit Polyclonal Anti-ACADS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACADS Antibody: synthetic peptide directed towards the N terminal of human ACADS. Synthetic peptide located within the following region: ASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGN |
Rabbit Polyclonal Anti-ACADS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACADS Antibody: synthetic peptide directed towards the middle region of human ACADS. Synthetic peptide located within the following region: FTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEA |
Rabbit Polyclonal Anti-ECHS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECHS1 antibody: synthetic peptide directed towards the N terminal of human ECHS1. Synthetic peptide located within the following region: IIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAI |
Rabbit Polyclonal Anti-ECHS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECHS1 antibody: synthetic peptide directed towards the middle region of human ECHS1. Synthetic peptide located within the following region: RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIA |
Rabbit Polyclonal Anti-ECHS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECHS1 antibody: synthetic peptide directed towards the C terminal of human ECHS1. Synthetic peptide located within the following region: KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ |
Rabbit Polyclonal Anti-ABAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT |
Rabbit Polyclonal Anti-ABAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW |
Rabbit Polyclonal Anti-ALDH5A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH5A1 antibody: synthetic peptide directed towards the middle region of human ALDH5A1. Synthetic peptide located within the following region: AFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM |
Rabbit Polyclonal Anti-ALDH9A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH9A1 antibody: synthetic peptide directed towards the C terminal of human ALDH9A1. Synthetic peptide located within the following region: MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC |
Rabbit Polyclonal Anti-ACSM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSM3 antibody: synthetic peptide directed towards the N terminal of human ACSM3. Synthetic peptide located within the following region: SMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMR |
Mouse Monoclonal ALDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey, Hamster |
| Conjugation | Unconjugated |
USD 380.00
4 Weeks
Mouse Monoclonal Aldehyde dehydrogenase 10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-ALDH9A1, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKEILDKFTEEVVKQ., from the internal region of the protein sequence according to NP_000687.3. |
Goat Anti-ALDH5A1 (aa 485-496), Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SQDPAQIWRVAE., from the internal region of the protein sequence according to NP_733936.1; NP_001071.1. |
Carrier-free (BSA/glycerol-free) GAD1 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
